MTALTLPEDIRQQEPSALLYTLVSAYLEHTAQTGDESLSCLSDDQHTLTAFCYLDSQVEEGGFVQLIASGYGEYIFRNPL
ADSLRRWKIKAVPKVLDKAKALYEQHGKTIETLADGGADIPSLRKQFPEFEEWDGAYYEAAEQDLPLLAEHIQSNWETFA
HIGQA
The query sequence (length=165) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3wur:B | 165 | 165 | 1.0000 | 1.0000 | 1.0000 | 2.76e-122 | 3wur:A |
2 | 1i0r:A | 161 | 27 | 0.0545 | 0.0559 | 0.3333 | 1.5 | 1i0s:A |
3 | 2bes:C | 158 | 105 | 0.1697 | 0.1772 | 0.2667 | 2.2 | 2bes:A, 2bes:B, 2bes:D, 2bes:E, 2bet:A, 2bet:B, 2bet:C, 2bet:D, 2bet:E, 1usl:A, 1usl:B, 1usl:C, 1usl:D, 1usl:E, 2vvo:A, 2vvo:B, 2vvo:C, 2vvo:D, 2vvo:E, 2vvp:A, 2vvp:B, 2vvp:C, 2vvp:D, 2vvp:E, 2vvq:A, 2vvq:B, 2vvq:C, 2vvq:D, 2vvq:E |
4 | 4lej:A | 355 | 27 | 0.0667 | 0.0310 | 0.4074 | 4.0 | |
5 | 1elt:A | 236 | 51 | 0.0848 | 0.0593 | 0.2745 | 5.8 | |
6 | 2p0a:A | 298 | 101 | 0.1455 | 0.0805 | 0.2376 | 5.9 | 2p0a:B |
7 | 9bh5:CD | 289 | 44 | 0.0727 | 0.0415 | 0.2727 | 9.1 | 9cai:CD |