MTAESMLANGAFIMIGLTLLGLAWGFVIIKLQGSEE
The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7zxy:F | 36 | 36 | 1.0000 | 1.0000 | 1.0000 | 3.54e-19 | 7r0w:N, 7r0w:F, 7zxy:N |
| 2 | 1q90:M | 34 | 26 | 0.3333 | 0.3529 | 0.4615 | 0.008 | |
| 3 | 7zyv:F | 37 | 26 | 0.3333 | 0.3243 | 0.4615 | 0.018 | 7qrm:F, 7qrm:N, 6rqf:N, 6rqf:F, 7zyv:N |
| 4 | 2d2c:F | 35 | 36 | 0.3611 | 0.3714 | 0.3611 | 5.3 | 2d2c:S, 2e74:F, 2e75:F, 2e76:F, 4h0l:F, 4h13:F, 4i7z:F, 4pv1:F, 1vf5:F, 1vf5:S |
umich.edu