BioLiP

>protein
MSYRVSTGAAHAAKGGGLVSGDSYSMMELGARKYAAAISDGARAHFESNETIKLLEKILESGIDEKIAIKTINSILSLRT
TDEIYSTLDLSIIDLQDASCKFLKVGSTPSFIKRGDQVMKVQASNLPIGIINEFDVEVVSEQLKAGDLLIMMSDGIFEGP
KHVENHDLWMKRKMKGLKTNDPQEIADLLMEEVIRTRSGQIEDDMTVVVVRIDHNTPKWASIPVPAI

The query sequence (length=227) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3t9q:B	227	227	1.0000	1.0000	1.0000	4.64e-169	3t91:A, 3t91:B, 3t9q:A
2	3pu9:A	236	217	0.2203	0.2119	0.2304	4.54e-06	3pu9:B
3	8k7p:A	382	69	0.1101	0.0654	0.3623	0.072	8k7p:B, 8k7q:A, 8k7q:B, 6ksi:A, 6ksi:B, 6ksl:A, 6ksl:B, 6ksm:A, 6ksm:B, 8s9r:A, 8s9r:B, 8yib:A, 8yib:B
4	8elf:B	384	71	0.0837	0.0495	0.2676	0.56	8elf:A
5	7yq8:A	730	90	0.1057	0.0329	0.2667	1.4	7yq8:B, 5zad:A, 5zad:B, 5zen:A, 5zqf:A
6	7qix:R	150	27	0.0617	0.0933	0.5185	1.7	8auv:W, 8b2l:W1, 7qiz:HA
7	3ke6:A	354	77	0.0837	0.0537	0.2468	2.1	3ke6:B
8	3ujk:A	298	51	0.0881	0.0671	0.3922	4.7	3nmv:B, 3ujl:B
9	3in1:A	312	21	0.0529	0.0385	0.5714	6.5	3in1:B
10	7oik:A	4426	66	0.0969	0.0050	0.3333	6.6	7oim:A, 6tax:A, 6tay:A
11	3lxf:A	104	30	0.0441	0.0962	0.3333	7.2	3lxf:B, 3lxf:C, 3lxf:D, 3lxf:E
12	7k1r:A	536	24	0.0485	0.0205	0.4583	7.7	7k1r:B, 7k1r:C, 7k1r:D, 8uws:C, 8uws:D, 8uws:A, 8uws:B
13	7xf0:C	598	33	0.0661	0.0251	0.4545	10.0	7xf0:A, 7xf0:B, 7xf1:A, 7xg3:L, 7xg4:L

[Back]