MSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEAN
AA
The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5fvl:A | 83 | 82 | 1.0000 | 0.9880 | 1.0000 | 2.77e-55 | 5fvk:A, 5fvk:B, 5fvl:B, 4niq:A, 4niq:B |
2 | 4u7y:A | 83 | 81 | 0.4512 | 0.4458 | 0.4568 | 1.83e-14 | 2jqk:A |
3 | 2k3w:A | 73 | 69 | 0.4024 | 0.4521 | 0.4783 | 2.70e-13 | 2jq9:A |
4 | 2ymb:D | 231 | 69 | 0.2683 | 0.0952 | 0.3188 | 4.64e-09 | 4a5x:A, 4a5x:B, 2ymb:C |
5 | 1chm:A | 401 | 34 | 0.1585 | 0.0324 | 0.3824 | 0.55 | 1chm:B |
6 | 6enz:A | 487 | 43 | 0.1707 | 0.0287 | 0.3256 | 0.92 | 6enz:B |
7 | 6gne:B | 494 | 28 | 0.1585 | 0.0263 | 0.4643 | 3.8 | 6gne:A |
8 | 4v7e:BY | 138 | 64 | 0.2317 | 0.1377 | 0.2969 | 4.3 | 8ip8:ba, 8ip9:ba, 8ipa:ba, 8ipb:ba, 8jiw:BY, 4v3p:SU |
9 | 6dql:A | 227 | 50 | 0.1829 | 0.0661 | 0.3000 | 5.4 | |
10 | 6p2l:A | 685 | 59 | 0.2195 | 0.0263 | 0.3051 | 8.0 | |
11 | 5mul:A | 378 | 49 | 0.1951 | 0.0423 | 0.3265 | 8.2 | |
12 | 4iee:A | 452 | 45 | 0.1463 | 0.0265 | 0.2667 | 10.0 | 5c12:A, 5c15:A, 5c2d:A, 5c2f:A, 4iei:A, 4ife:A |