MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPN
QGNLIVNVELLPLAYETFEPGPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLA
SVAALYNTKVYKVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKG
SMSLQDIDQAENTARSTAVKLLEELKKHLG
The query sequence (length=270) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4ba2:A | 274 | 271 | 1.0000 | 0.9854 | 0.9963 | 0.0 | 2c37:I, 2c37:U, 2c38:G, 2c38:I, 2c38:U, 2c38:W, 2jea:A |
2 | 2pnz:B | 267 | 258 | 0.4519 | 0.4569 | 0.4729 | 1.95e-66 | |
3 | 3m85:I | 259 | 261 | 0.4222 | 0.4402 | 0.4368 | 4.63e-55 | 3m7n:I, 3m7n:G, 3m7n:H, 3m85:G, 3m85:H |
4 | 6d6q:C | 265 | 260 | 0.3074 | 0.3132 | 0.3192 | 6.50e-42 | 6d6r:C |
5 | 6d6q:A | 287 | 263 | 0.2963 | 0.2787 | 0.3042 | 1.10e-28 | 6d6r:A |
6 | 4ifd:A | 300 | 241 | 0.2667 | 0.2400 | 0.2988 | 9.67e-25 | 6fsz:AA |
7 | 3m7n:E | 248 | 250 | 0.2148 | 0.2339 | 0.2320 | 1.30e-13 | 3m7n:F, 3m7n:D, 3m85:F, 3m85:D, 3m85:E |
8 | 3dd6:A | 244 | 251 | 0.2370 | 0.2623 | 0.2550 | 3.97e-11 | |
9 | 1r6m:A | 236 | 219 | 0.2333 | 0.2669 | 0.2877 | 3.68e-10 | |
10 | 2c39:D | 248 | 236 | 0.2000 | 0.2177 | 0.2288 | 1.22e-08 | 4ba1:B, 4ba2:B, 2c37:B, 2c37:F, 2c37:N, 2c37:V, 2c37:X, 2c38:B, 2c38:F, 2c38:H, 2c38:J, 2c38:N, 2c38:V, 2c38:X, 2c39:B, 2c39:F, 2c39:H, 2c39:J, 2c39:L, 2c39:N, 2c39:P, 2c39:R, 2c39:T, 2c39:V, 2c39:X, 2jea:B |
11 | 2wnr:B | 222 | 249 | 0.2111 | 0.2568 | 0.2289 | 2.57e-08 | 2wnr:D, 2wnr:F |
12 | 2pnz:A | 236 | 206 | 0.1704 | 0.1949 | 0.2233 | 3.68e-08 | 2po0:A, 2po1:A, 2po2:A |
13 | 8wx0:A | 597 | 47 | 0.0741 | 0.0335 | 0.4255 | 0.007 | 8wx0:B, 8wx0:C |
14 | 7ld5:A | 587 | 47 | 0.0741 | 0.0341 | 0.4255 | 0.012 | 7ld5:B, 7ld5:C |
15 | 4oo1:E | 255 | 206 | 0.1630 | 0.1725 | 0.2136 | 0.020 | |
16 | 6d6q:B | 241 | 214 | 0.1778 | 0.1992 | 0.2243 | 0.047 | 6d6r:B |
17 | 5yjj:A | 442 | 53 | 0.0704 | 0.0430 | 0.3585 | 0.072 | 5yjj:B, 5yjj:C, 5yjj:D, 5yjj:E, 5yjj:F |
18 | 1e3p:A | 645 | 44 | 0.0630 | 0.0264 | 0.3864 | 0.15 | |
19 | 1e3p:A | 645 | 83 | 0.1111 | 0.0465 | 0.3614 | 8.1 | |
20 | 4aim:A | 698 | 179 | 0.1741 | 0.0673 | 0.2626 | 0.97 | 4aid:A, 4aid:B, 4aid:C, 4am3:A, 4am3:C, 4am3:B |
21 | 4aim:A | 698 | 105 | 0.0963 | 0.0372 | 0.2476 | 7.7 | 4aid:A, 4aid:B, 4aid:C, 4am3:A, 4am3:C, 4am3:B |
22 | 6ogz:A | 1082 | 94 | 0.1037 | 0.0259 | 0.2979 | 4.7 | 6ogy:A, 6oj6:P, 2r7r:A, 2r7s:A, 2r7t:A, 2r7u:A, 2r7v:A, 2r7w:A, 2r7x:A, 2r7x:B |