BioLiP

>protein
MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPN
QGNLIVNVELLPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVY
KVEQISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAE
NTARSTAVKLLEELKKHLGI

The query sequence (length=260) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4ba2:A	274	272	1.0000	0.9489	0.9559	0.0	2c37:I, 2c37:U, 2c38:G, 2c38:I, 2c38:U, 2c38:W, 2jea:A
2	2pnz:B	267	258	0.4346	0.4232	0.4380	8.51e-56
3	3m85:I	259	261	0.4038	0.4054	0.4023	3.78e-44	3m7n:I, 3m7n:G, 3m7n:H, 3m85:G, 3m85:H
4	6d6q:C	265	260	0.3000	0.2943	0.3000	1.85e-34	6d6r:C
5	6d6q:A	287	263	0.2923	0.2648	0.2890	5.35e-22	6d6r:A
6	4ifd:A	300	241	0.2615	0.2267	0.2822	5.44e-21	6fsz:AA
7	3m7n:E	248	250	0.2154	0.2258	0.2240	2.36e-10	3m7n:F, 3m7n:D, 3m85:F, 3m85:D, 3m85:E
8	1r6m:A	236	219	0.2385	0.2627	0.2831	2.57e-09
9	3dd6:A	244	251	0.2346	0.2500	0.2430	3.82e-09
10	2c39:D	248	236	0.2115	0.2218	0.2331	6.43e-06	4ba1:B, 4ba2:B, 2c37:B, 2c37:F, 2c37:N, 2c37:V, 2c37:X, 2c38:B, 2c38:F, 2c38:H, 2c38:J, 2c38:N, 2c38:V, 2c38:X, 2c39:B, 2c39:F, 2c39:H, 2c39:J, 2c39:L, 2c39:N, 2c39:P, 2c39:R, 2c39:T, 2c39:V, 2c39:X, 2jea:B
11	2wnr:B	222	249	0.2115	0.2477	0.2209	4.42e-05	2wnr:D, 2wnr:F
12	2pnz:A	236	206	0.1692	0.1864	0.2136	9.31e-05	2po0:A, 2po1:A, 2po2:A
13	4oo1:E	255	197	0.1692	0.1725	0.2234	0.006
14	8wx0:A	597	47	0.0769	0.0335	0.4255	0.008	8wx0:B, 8wx0:C
15	7ld5:A	587	47	0.0769	0.0341	0.4255	0.012	7ld5:B, 7ld5:C
16	5yjj:A	442	53	0.0731	0.0430	0.3585	0.058	5yjj:B, 5yjj:C, 5yjj:D, 5yjj:E, 5yjj:F
17	6d6q:B	241	44	0.0615	0.0664	0.3636	0.11	6d6r:B
18	1e3p:A	645	44	0.0654	0.0264	0.3864	0.16

[Back]