MSSGYPGVSWNKRMCAWLAFFYDGASRRSRTFHPKHFNMDKEKARLAAVEFMKTVE
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3igm:B | 62 | 56 | 1.0000 | 0.9032 | 1.0000 | 2.65e-38 | 3igm:A |
2 | 7ana:AAA | 475 | 44 | 0.2143 | 0.0253 | 0.2727 | 2.4 | 7ana:BBB, 7anb:AAA, 7anb:BBB |
3 | 3dt7:A | 624 | 35 | 0.1786 | 0.0160 | 0.2857 | 5.5 | 3dt2:A, 3dt4:A, 3dt4:C, 3dt7:B, 3dtb:A, 3dtb:B, 5fh0:A, 5fh1:A, 5fh2:A, 5fh3:A, 5fh4:A, 5fh5:A, 2gmv:A, 2gmv:B, 4gmm:A, 4gmu:A, 4gmw:A, 4gmz:A, 4gnl:A, 4gnm:A, 4gno:A, 4gnp:A, 4gnq:A, 1khb:A, 1khe:A, 1khf:A, 1khg:A, 7l36:A, 7l3m:A, 7l3v:A, 1m51:A, 3moe:A, 3mof:A, 3mof:B, 3moh:A, 3moh:B, 1nhx:A, 4ox2:A, 4ox2:B, 6p5o:A, 2qew:A, 2qey:A, 2qf1:A, 2qf2:A, 2qf2:B, 2rk7:A, 2rk7:B, 2rk8:A, 2rk8:B, 2rka:A, 2rka:C, 2rkd:A, 2rke:A, 5v97:A, 5v9f:A, 5v9g:A, 5v9h:A, 5v9h:B, 4yw8:A, 4yw9:A, 4ywb:A, 4ywb:C, 4ywd:A |
4 | 6pd0:A | 366 | 34 | 0.1964 | 0.0301 | 0.3235 | 8.7 | 6pcz:A, 6pcz:B, 6pd0:B |
5 | 3esw:A | 333 | 25 | 0.1607 | 0.0270 | 0.3600 | 8.8 | 1x3w:A, 1x3z:A |