MSRNVDKANSVLVRFQEQQAESAGGYKDYSRYQRPRNVSKVKSIKEANEWKRQVSKEIKQKSTRIYDPSLNEMQIAELND
ELNNLFKEWKRWQWHID
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7b9v:G | 138 | 96 | 0.9278 | 0.6522 | 0.9375 | 9.25e-60 | 5gmk:H, 6j6n:H, 6j6q:H, 5lj3:G, 5lj5:G |
2 | 5yzg:y | 112 | 92 | 0.3093 | 0.2679 | 0.3261 | 1.59e-11 | 8i0w:z |
3 | 4x8c:A | 554 | 69 | 0.2062 | 0.0361 | 0.2899 | 0.15 | |
4 | 2vq5:A | 173 | 67 | 0.1546 | 0.0867 | 0.2239 | 0.62 | 5non:A, 5non:B, 5non:C, 6rp3:A, 2vq5:B, 6z82:A |
5 | 7yh2:A | 156 | 33 | 0.1546 | 0.0962 | 0.4545 | 1.2 | 7yh2:B |
6 | 5j7w:C | 315 | 40 | 0.1134 | 0.0349 | 0.2750 | 1.3 | 5j7w:D, 4o7u:B, 4o7u:D, 6qxs:B, 6qxs:D, 6qya:B, 6qya:D, 3uwl:B, 3uwl:D |
7 | 4c4o:B | 335 | 18 | 0.0928 | 0.0269 | 0.5000 | 3.0 | 4c4o:A, 4c4o:C, 4c4o:D, 3wle:A, 3wle:B, 3wle:C, 3wle:D, 3wlf:A, 3wlf:B, 3wlf:C, 3wlf:D, 3wnq:A, 3wnq:B, 3wnq:C, 3wnq:D |
8 | 8tcf:B | 359 | 60 | 0.1546 | 0.0418 | 0.2500 | 3.7 | 6om1:B, 6om1:D, 6om1:F, 6om1:H, 6om2:B, 6om2:D, 6uja:B, 6ujb:B, 6ujc:B, 8vs6:B, 8vsd:B, 7y1t:B |
9 | 8pmq:2 | 355 | 92 | 0.2062 | 0.0563 | 0.2174 | 4.4 | 7ns4:b |
10 | 8btd:SG | 238 | 28 | 0.1134 | 0.0462 | 0.3929 | 7.2 | 8brm:SG, 8bsi:SG, 8bsj:SG, 8btr:SG |