MSRIDSDLQKALKKACSVEETAPKRKHVRACIVYTWDHQSSKAVFTTLKTLPLANDEVQLFKMLIVLHKIIQEGHPSALA
EAIRDRDWIRSLGRVHSGGSSYSKLIREYVRYLVLKLDFHAHHRGFNNGTFEYEEYVSLVSVSDPDEGYETILDLMSLQD
SLDEFSQIIFASIQSERRNTECKISALIPLIAESYGIYKFITSMLRAMHRQLQPLKERYELQHARLFEFYADCSSVKYLT
TLVTIPK
The query sequence (length=247) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7b2l:B | 247 | 247 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7b2l:G, 7b2l:L, 7b2l:Q |
2 | 6t5z:A | 174 | 76 | 0.0729 | 0.1034 | 0.2368 | 0.75 | 6t5z:B, 6t5z:C |
3 | 3n9s:A | 307 | 48 | 0.0607 | 0.0489 | 0.3125 | 1.5 | 3c4u:A, 3c4u:B, 3c52:A, 3c52:B, 3c56:A, 3c56:B, 3n9r:A, 3n9r:B, 3n9r:K, 3n9r:P, 3n9r:U, 3n9r:Z, 3n9r:e, 3n9r:j, 3n9s:B, 5uck:A, 5uck:B, 5ucn:A, 5ucn:B, 5ucp:A, 5ucp:B, 5ucs:A, 5ucs:B, 5ucz:A, 5ucz:B, 5ud0:B, 5ud2:A, 5ud2:B, 5ud3:A, 5ud3:B, 5ud4:A, 5ud4:B, 5vjf:A, 5vjf:B |
4 | 7q3a:B | 340 | 61 | 0.0769 | 0.0559 | 0.3115 | 4.2 | 7q3a:A |
5 | 3ocu:A | 247 | 32 | 0.0405 | 0.0405 | 0.3125 | 5.4 | 3et4:A, 3et5:A, 3ocv:A, 3ocw:A, 3ocx:A, 3ocy:A, 3ocz:A, 3sf0:A |