BioLiP

>protein
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFDSHILEKAVEYLNYNLKYSGVSEDDDEIPEF
EIPTEMSLELLLAADYLSI

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1hv2:A	99	99	1.0000	1.0000	1.0000	3.14e-68
2	2jz3:C	96	96	0.3838	0.3958	0.3958	4.10e-18	9bju:K, 6gmn:B, 6gmx:B
3	6gmn:K	87	93	0.3434	0.3908	0.3656	2.67e-15	3dcg:D, 3dcg:B, 6gmx:K
4	8zuh:B	137	99	0.2727	0.1971	0.2727	0.004
5	3c4w:B	519	62	0.2222	0.0424	0.3548	0.006	3c4w:A, 3c4x:A, 3c4x:B, 3c4z:A, 3c50:A, 3c50:B, 3c51:A, 4l9i:A, 4l9i:B, 7mt8:G, 7mt9:G, 7mta:G, 7mtb:G, 4pni:A, 3qc9:A, 3qc9:B, 3qc9:C, 3qc9:D, 3t8o:A, 4wbo:A, 4wbo:B, 4wbo:C, 4wbo:D
6	6u5w:A	1435	103	0.3131	0.0216	0.3010	0.25
7	7udj:H	192	50	0.1212	0.0625	0.2400	1.9
8	5xy3:E	135	55	0.1616	0.1185	0.2909	6.4
9	3avt:A	1203	27	0.1111	0.0091	0.4074	7.1	7abz:6, 5afi:z, 3agp:A, 3agq:A, 3avu:A, 3avv:A, 3avw:A, 3avx:A, 3avy:A, 7bbn:A, 7bbn:B, 2bvn:A, 2bvn:B, 1efm:A, 1etu:A, 4fwt:A, 2hcj:A, 2hcj:B, 2hdn:A, 2hdn:B, 2hdn:C, 2hdn:D, 2hdn:E, 2hdn:F, 2hdn:G, 2hdn:H, 2hdn:I, 2hdn:J, 2hdn:K, 2hdn:L, 5i4r:C, 5i4r:D, 5i4r:G, 5i4r:H, 3mmp:G, 5opd:A, 5opd:B, 4pc2:A, 4pc2:B, 4pc3:A, 4pc3:B, 4pc6:A, 4pc6:B, 4pc7:A, 3u6b:B, 3u6b:A, 3vnu:A, 3vnv:A, 6wd4:8, 6wd7:8, 6wd9:8, 6wda:8

[Back]