MSLQFIGLQRRDVVALVNFLRHLTQKPDVDLEAHPKILKKCGEKRLHRRTVLFNELMLWLGYYRELRFHNPDLSSVLEEF
EVRCVAVARRGYTYPFGDRGKARDHLAVLDRTEFDTDVRHDAEIVERALVSAVILAKMSVRETLVTAIGQTEPIAFVHLK
DTEVQRIEENLEGVRRNMFCVKPLDLNLDRHANTALVNAVNKLVYTGRLIMNVRRSWEELERKCLARIQERCKLLVKELR
MCLSFDSNYCRNILKHAVENGDSADTLLELLIEDFDIYVDSFPQS
The query sequence (length=285) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7lj3:0 | 285 | 285 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7lj3:z, 7lj3:5, 7lj3:6, 7lj3:8, 7lj3:9 |
2 | 4v58:G | 2060 | 122 | 0.0877 | 0.0121 | 0.2049 | 0.50 | 4v58:H, 4v58:I, 4v58:J, 4v58:K, 4v58:L, 4v59:G, 4v59:H, 4v59:I, 4v59:J, 4v59:K, 4v59:L |
3 | 8hi1:A | 289 | 95 | 0.0877 | 0.0865 | 0.2632 | 0.58 | 8hi1:C |
4 | 5lj7:A | 592 | 56 | 0.0667 | 0.0321 | 0.3393 | 0.92 | |
5 | 5lil:A | 615 | 56 | 0.0667 | 0.0309 | 0.3393 | 0.95 | 5lil:B, 5lj6:A, 5lj7:B |
6 | 5dmh:A | 420 | 71 | 0.0772 | 0.0524 | 0.3099 | 0.96 | |
7 | 6j6h:v | 722 | 50 | 0.0561 | 0.0222 | 0.3200 | 1.1 | 6j6n:v, 6j6q:v |
8 | 3zfd:A | 340 | 54 | 0.0561 | 0.0471 | 0.2963 | 3.1 | 3zfc:A |
9 | 7f16:R | 376 | 117 | 0.1018 | 0.0771 | 0.2479 | 3.1 | |
10 | 3ci0:K | 280 | 95 | 0.0912 | 0.0929 | 0.2737 | 3.6 | |
11 | 7nkg:B | 432 | 74 | 0.0667 | 0.0440 | 0.2568 | 3.7 | 7nkg:E, 7nkg:H, 7nkg:K |
12 | 7ww4:A | 480 | 36 | 0.0491 | 0.0292 | 0.3889 | 5.2 | 7wwc:A |