MSKLDSLLKELPTRTAHLYRSIWHKYTEWLKTMPDDLKLFLSQKYIVKYIASHDDIAKDPLPTCDAMIWFSRALDIENND
VLVLQQRLYGLVKLLEFDYSNVIAILQKISINLWNPSTDSLQSKHFKTCQDKLKLLLDFQWKFNTNVSFEDRTTVSLKDL
QCILDDENGKCGLAHSSKPNFVLVPNFQSPFTCPIFTMAVYYYLRFHGVKKYYKGDGYQILSQLEHIPIIRGKSLDQYPR
ELTLGNWYPTIFKYCQLPYTKKHWFQVNQEWPQFPDFSESDSENTIGIPDFYIEKMNRTKLQPCPQVHVHLFPTDLPPDI
QAVFDLLNSVLVTSLPLLYRVFPTHDIFLDPSLKTPQNIAFLTGTLPLDIESQEHLLAQLIDKTGTVS
The query sequence (length=388) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3sqi:A | 388 | 388 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 3t79:A, 3t79:D |
2 | 6gys:E | 506 | 305 | 0.2603 | 0.1996 | 0.3311 | 1.87e-40 | 6gys:L |
3 | 3ov0:A | 318 | 85 | 0.0619 | 0.0755 | 0.2824 | 0.34 | 3oue:A, 3ouq:A, 1rwj:A |
4 | 8gwh:A | 295 | 43 | 0.0412 | 0.0542 | 0.3721 | 0.43 | |
5 | 4hln:A | 504 | 71 | 0.0515 | 0.0397 | 0.2817 | 1.4 | |
6 | 6ghs:A | 285 | 62 | 0.0490 | 0.0667 | 0.3065 | 3.8 | |
7 | 1rmd:A | 116 | 29 | 0.0284 | 0.0948 | 0.3793 | 4.4 | |
8 | 6gne:B | 494 | 39 | 0.0361 | 0.0283 | 0.3590 | 4.8 | 6gne:A |
9 | 8gvg:A | 203 | 86 | 0.0619 | 0.1182 | 0.2791 | 8.0 | 8gvb:A, 4h1l:I, 4h1l:G, 3vxm:D |
10 | 3mbe:C | 192 | 90 | 0.0644 | 0.1302 | 0.2778 | 9.3 | 3mbe:G |