BioLiP

>protein
MSISDTQVYIALVVALVPGFLAWRLATELYK

The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6k61:M	31	30	0.9032	0.9032	0.9333	1.08e-14	6jeo:aM, 6jeo:bM, 6jeo:cM, 6jeo:dM, 6k61:m, 7lx0:V, 7lx0:m, 7lx0:M, 6pnj:M, 6pnj:V, 6pnj:m, 6tcl:M1, 6tcl:M2, 6tcl:M, 6tcl:MM, 7y3f:M
2	7qco:T	31	31	0.8065	0.8065	0.8065	1.53e-13	6vpv:M, 6vpv:m, 6vpv:z
3	7s3d:M	31	31	0.6774	0.6774	0.6774	1.37e-11	7s3d:V, 7s3d:m
4	6kmw:aM	31	31	0.6774	0.6774	0.6774	5.59e-11	6kmw:bM, 6kmw:cM, 6kmx:aM, 6kmx:bM, 6kmx:cM
5	4fe1:M	31	31	0.6774	0.6774	0.6774	6.81e-11	7fix:M1, 7fix:M2, 7fix:M3, 1jb0:M, 6k33:aM, 6k33:bM, 6k33:cM, 6lu1:M, 7m75:M, 7m76:M, 3pcq:M, 6pfy:M, 6pfy:V, 6pfy:i, 6pgk:M, 6pgk:V, 6tra:M, 6trc:M, 6trc:m, 6trc:y, 6trd:m, 6trd:y, 5zf0:M1, 5zf0:M2, 5zf0:M3, 5zf0:M4, 5zf0:M6, 5zf0:M5
6	8am5:m	31	31	0.7097	0.7097	0.7097	8.67e-11	8asl:m, 8asp:m, 6hqb:M, 4kt0:M, 4l6v:M, 4l6v:m, 4l6v:7, 6nwa:M, 6nwa:m, 6nwa:V, 7o1v:M, 5oy0:M, 5oy0:m, 5oy0:9, 7umh:M, 7umh:V, 7umh:m, 6uzv:M, 6uzv:m, 6uzv:9
7	7yca:M	31	31	0.6129	0.6129	0.6129	5.60e-08
8	6igz:M	31	30	0.5161	0.5161	0.5333	6.93e-07
9	7xqp:M	32	30	0.5161	0.5000	0.5333	1.24e-05	8htu:M, 7ksq:M, 7kux:M
10	8wm6:M	30	29	0.5484	0.5667	0.5862	3.02e-05	8wmj:M, 8wmv:M, 8wmw:M, 7y7b:M, 7y8a:M
11	6l4u:M	30	29	0.5484	0.5667	0.5862	7.12e-05
12	7a4p:M	31	31	0.5161	0.5161	0.5161	4.98e-04	6zzx:M, 6zzy:M
13	7y5e:MN	30	28	0.5161	0.5333	0.5714	0.65	7y5e:M2, 7y7a:M7, 7y7a:Mo
14	7pua:FO	328	28	0.3226	0.0305	0.3571	2.4	6sga:FO, 6sgb:FO
15	7pub:FO	267	28	0.3226	0.0375	0.3571	2.5
16	4uw9:A	228	18	0.2581	0.0351	0.4444	4.4
17	3pzi:A	357	27	0.3226	0.0280	0.3704	8.1	3pzo:A, 3pzq:A

[Back]