BioLiP

>protein
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQW
RDARQVYGLNFGSKEDANVFASAMMHALEVL

The query sequence (length=111) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7aki:A	113	111	1.0000	0.9823	1.0000	1.27e-82	9c66:A, 1evh:A, 4my6:A, 4my6:B, 5n91:B, 5n91:A, 5n9c:A, 5n9c:B, 5n9p:B, 5n9p:A, 5naj:A, 5naj:B, 5naj:D, 5naj:C, 5nbf:A, 5nbx:A, 5nbx:B, 5nc2:A, 5nc2:B, 5nc7:C, 5nc7:A, 5nc7:B, 5nc7:D, 5ncf:A, 5ncf:B, 5ncg:A, 5ncg:B, 5ncp:A, 5nd0:A, 5nd0:B, 5ndu:A, 5ndu:B, 5neg:A, 5neg:B, 6rcf:A, 6rcj:A, 6rd2:B, 6rd2:A, 6xvt:A, 6xvt:B, 6xxr:B, 6xxr:A
2	1qc6:A	108	111	0.7027	0.7222	0.7027	8.83e-56	1qc6:B
3	6v65:A	110	107	0.3243	0.3273	0.3364	6.97e-19	6v6f:A
4	5zz9:B	114	110	0.3153	0.3070	0.3182	3.51e-11	1i7a:A, 1i7a:B, 1i7a:D, 5zz9:A, 5zz9:C
5	1ddv:A	104	107	0.2883	0.3077	0.2991	4.14e-08
6	7uoo:w	194	27	0.0991	0.0567	0.4074	0.55	5a53:A, 7bt6:w, 7btb:w, 6ft6:w, 3jct:w, 6m62:w, 7oh3:w, 7ohq:w, 7oht:w, 7ug6:w, 7uqb:w, 7uqz:w, 7v08:w
7	6fnd:A	423	42	0.1441	0.0378	0.3810	1.2	6fnd:B, 6fnd:C, 6fnd:D
8	3ieh:A	268	99	0.2072	0.0858	0.2323	2.2
9	4era:A	332	57	0.1171	0.0392	0.2281	3.4	4epk:A, 4epk:B, 4era:B, 4erg:A, 4erg:B, 4eri:A, 4eri:B, 2hbv:A, 2hbv:B, 2hbx:A, 2hbx:B, 4ifk:A, 4ifk:B, 4ifo:A, 4ifo:B, 4ifr:A, 4ifr:B, 4ig2:A, 4ig2:B, 7k12:A, 7k13:A, 7k13:B, 7k13:C, 6mgs:A, 6mgs:B, 6mgs:C, 6mgt:A, 6mgt:B
10	5u7w:A	404	28	0.1081	0.0297	0.4286	4.0	5u7v:A
11	5cee:A	387	25	0.1081	0.0310	0.4800	6.4

[Back]