MSELNALLKDINGSLTATSESLERLSGIYSNSATDEIPESNQLHEHLFYDAKKPAEKVSLLSLKNGSMLGYINSLLMLIG
NRLDDECKDPSAMDARERSIQHRVVLERGVKPLEKKLAYQLDKLTRAYVKMEKEYKDAEKRTHFEDRFDAREHKDRSNKS
RMQAMEEYIRESSDQPDWSASIGADIVNHGRGGIKSLRDTEKERRVTSFEEDNFTRLNITNKAEKRKQKQRERNARMNVI
GGEDFGIFSSKRKLEDSTSRRGAKKTRSAWDRAQRRL
The query sequence (length=277) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7suk:6 | 277 | 277 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7d63:RB, 6ke6:RB, 6lqp:RB, 6lqq:RB, 6lqr:RB, 6lqu:RB, 6lqv:RB, 5wlc:NC, 6zqb:JE |
2 | 6rxu:CY | 123 | 116 | 0.1516 | 0.3415 | 0.3621 | 2.19e-04 | 6rxv:CY, 6rxz:CY |
3 | 7ase:C | 696 | 29 | 0.0578 | 0.0230 | 0.5517 | 1.5 | |
4 | 6z1p:Az | 237 | 37 | 0.0505 | 0.0591 | 0.3784 | 2.9 | |
5 | 4mn7:B | 142 | 33 | 0.0397 | 0.0775 | 0.3333 | 3.0 |