MSDNIRRSMPLFPIGIVMQLTELSARQIRYYEENGLIFPARTEGNRRLFSFHDVDKLLEIKHLIEQGVNMAGIKQILAKA
EAEP
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4r4e:B | 84 | 84 | 1.0000 | 1.0000 | 1.0000 | 1.63e-58 | |
2 | 7tec:A | 72 | 69 | 0.5595 | 0.6528 | 0.6812 | 1.13e-30 | |
3 | 7tea:B | 78 | 77 | 0.4881 | 0.5256 | 0.5325 | 2.64e-25 | 7tea:E, 7tea:A, 7tea:C |
4 | 4r24:B | 85 | 75 | 0.4286 | 0.4235 | 0.4800 | 6.34e-19 | 4r22:B |
5 | 5c8d:E | 280 | 76 | 0.3452 | 0.1036 | 0.3816 | 3.36e-05 | 8c31:A, 8c31:B, 8c31:C, 8c31:D, 8c32:A, 8c32:B, 8c32:C, 8c32:D, 8c33:A, 8c33:B, 8c33:C, 8c33:D, 8c34:A, 8c34:B, 8c34:C, 8c34:D, 8c35:A, 8c35:B, 8c35:C, 8c35:D, 8c36:A, 8c36:B, 8c36:C, 8c36:D, 8c37:A, 8c37:B, 8c37:C, 8c37:D, 8c73:A, 8c73:B, 8c73:C, 8c73:D, 8c76:A, 8c76:B, 8c76:C, 8c76:D, 5c8a:A, 5c8a:B, 5c8a:C, 5c8a:D, 5c8d:A, 5c8d:B, 5c8d:C, 5c8d:D, 5c8d:F, 5c8d:G, 5c8d:H, 5c8e:A, 5c8e:B, 5c8e:C, 5c8e:E, 5c8e:F, 5c8e:G, 5c8e:D, 5c8e:H, 5c8f:A, 3whp:A |
6 | 6jni:A | 145 | 67 | 0.2500 | 0.1448 | 0.3134 | 1.52e-04 | 6jgw:B, 6jgw:A, 6jgx:A, 6jgx:B, 6jni:B, 6jni:H, 6jni:C, 6jni:D, 6jni:E, 6jni:F, 6jni:G, 6jyw:A, 6jyw:B |
7 | 5gpe:D | 129 | 68 | 0.2500 | 0.1628 | 0.3088 | 2.06e-04 | 5gpe:A, 5gpe:B, 5gpe:C, 5gpe:E, 5gpe:F, 5gpe:G, 5gpe:H |
8 | 4wlw:A | 130 | 58 | 0.2143 | 0.1385 | 0.3103 | 3.80e-04 | 7c17:G, 7c17:H, 6ldi:G, 6ldi:H, 1q05:A, 1q05:B, 4wls:A, 4wls:B, 6xh7:G, 6xh7:H, 6xh8:G, 6xh8:H |
9 | 2vz4:A | 100 | 50 | 0.1667 | 0.1400 | 0.2800 | 0.011 | |
10 | 7xn2:A | 148 | 55 | 0.1905 | 0.1081 | 0.2909 | 0.037 | |
11 | 1r8d:A | 109 | 67 | 0.2262 | 0.1743 | 0.2836 | 0.050 | 1r8d:B |
12 | 3gp4:A | 132 | 57 | 0.2381 | 0.1515 | 0.3509 | 0.11 | 3gp4:B |
13 | 5xbt:A | 271 | 68 | 0.2143 | 0.0664 | 0.2647 | 0.16 | 5xbi:A, 5xbi:B, 5xbt:B, 5xql:A |
14 | 5n61:Q | 389 | 53 | 0.2143 | 0.0463 | 0.3396 | 0.23 | |
15 | 4ua1:B | 125 | 67 | 0.2619 | 0.1760 | 0.3284 | 0.44 | 4ua1:A |
16 | 2zhg:A | 121 | 66 | 0.2143 | 0.1488 | 0.2727 | 0.85 | 2zhh:A |
17 | 6xl5:G | 268 | 66 | 0.1786 | 0.0560 | 0.2273 | 1.1 | 6wl5:A, 6wl5:B, 6wl5:C, 6wl5:D, 6xl5:H, 6xl6:G, 6xl6:H, 6xl9:G, 6xl9:H, 6xla:G, 6xla:H, 6xlj:G, 6xlj:H, 6xlk:G, 6xlk:H |
18 | 5f84:A | 365 | 47 | 0.1905 | 0.0438 | 0.3404 | 2.7 | 5f85:A, 5f87:A, 5f87:B, 5f87:C, 5f87:D, 5f87:E, 5f87:F |
19 | 6sus:A | 258 | 27 | 0.1190 | 0.0388 | 0.3704 | 3.3 | 5cvw:A, 5cxl:A, 5cxl:B |