MSDIVYMGNKALYLILIFSLWPVGIPFGIKLIGVSISLLLLSGWYGEVLLSFCHEIMFLIKSG
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8axk:J | 67 | 67 | 1.0000 | 0.9403 | 0.9403 | 1.19e-36 | 8axk:I |
| 2 | 8axk:H | 75 | 75 | 1.0000 | 0.8400 | 0.8400 | 2.70e-35 | |
| 3 | 3v8d:A | 479 | 17 | 0.1111 | 0.0146 | 0.4118 | 9.4 | 3dax:A, 3dax:B, 3sn5:A, 3sn5:B, 3v8d:B |
umich.edu