MSDILQELLRVSEKAANIARACRQQETLFQLDFKTLAAVLVQEVIKENMENKFPGLGKKIFGEESNELTNDLGEKIIMRL
GPTEEETVALLSKVLNGNKLASEALAKVVHQDVFFSDPALDSVEINIPQDILGIWVDPIDSTYQYIKGSADITPNQGIFP
SGLQCVTVLIGVYDIQTGVPLMGVINQPFVSQDLHTRRWKGQCYWGLSYLGTNIHSLLPPSVVISTSEKETRIFRAAGAG
YKSLCVILGLADIYIFSEDTTFKWDSCAAHAILRAMGGGMVDLKECLERPQLVYHVGNQWANKGGLIAYRSEKQLETFLS
RLLQH
The query sequence (length=325) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7kir:A | 326 | 326 | 1.0000 | 0.9969 | 0.9969 | 0.0 | 7kio:A |
2 | 1inp:A | 400 | 392 | 0.9969 | 0.8100 | 0.8265 | 0.0 | |
3 | 2wef:A | 303 | 213 | 0.1846 | 0.1980 | 0.2817 | 1.48e-16 | 1jp4:A |
4 | 4qxd:B | 289 | 161 | 0.1200 | 0.1349 | 0.2422 | 6.49e-05 | 4qxd:A |
5 | 5ci8:A | 117 | 98 | 0.0892 | 0.2479 | 0.2959 | 0.091 | 5ci9:A |
6 | 4iu2:A | 209 | 124 | 0.1015 | 0.1579 | 0.2661 | 0.33 | 8ajy:A, 8ajy:C, 4iu3:A |
7 | 8c6e:A | 124 | 32 | 0.0369 | 0.0968 | 0.3750 | 0.41 | 3q8i:A |
8 | 9evq:B | 214 | 112 | 0.1046 | 0.1589 | 0.3036 | 0.72 | 9evq:A, 9f5q:A, 9f5q:B |
9 | 5eq9:B | 260 | 69 | 0.0646 | 0.0808 | 0.3043 | 1.1 | 5eq8:A, 5eq9:A, 5eq9:C, 5eq9:D, 5t3j:A |
10 | 2p3n:A | 256 | 166 | 0.1200 | 0.1523 | 0.2349 | 2.3 | 2p3n:B, 2p3n:C, 2p3n:D |
11 | 6ey7:B | 227 | 69 | 0.0585 | 0.0837 | 0.2754 | 4.3 | 6ey7:A, 6ey7:C, 6ey7:D, 3n4p:A, 3n4p:B, 3n4p:C, 3n4p:D, 3n4q:A, 3n4q:B, 3n4q:C, 3n4q:D |
12 | 7q3e:D | 226 | 45 | 0.0462 | 0.0664 | 0.3333 | 8.7 | |
13 | 6ahr:L | 362 | 97 | 0.0831 | 0.0746 | 0.2784 | 8.8 | 6ahu:L |