MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEP
The query sequence (length=44) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7e4j:B | 44 | 44 | 1.0000 | 1.0000 | 1.0000 | 2.52e-25 | |
2 | 6sga:F3 | 888 | 29 | 0.2727 | 0.0135 | 0.4138 | 1.3 | 7pub:F3, 6sgb:F3 |
3 | 7pua:F3 | 911 | 29 | 0.2727 | 0.0132 | 0.4138 | 1.4 | |
4 | 8tj5:0 | 1246 | 21 | 0.1818 | 0.0064 | 0.3810 | 5.5 | 8tj5:Y |