MRVLIVKTSSMGDVLHTLPALTDAQQAIPGIKFDWVVEEGFAQIPSWHAAVERVIPVAIRRWRKAWFSAPIKAERKAFRE
ALQAKNYDAVIDAQGLVKSAALVTRLAHGVKHGMDWQTAREPLASLFYNRKHHIAKQQHAVERTRELFAKSLGYSKPQTQ
GDYAIAQHFLTNLPTDAGEYAVFLHATTRDDKHWPEEHWRELIGLLADSGIRIKLPWGAPHEEERAKRLAEGFAYVEVLP
KMSLEGVARVLAGAKFVVSVDTGLSHLTAALDRPNITVYGPTDPYGKNQMVCRAPGNELSQLTANAVKQFIEENA
The query sequence (length=315) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6dfe:B | 325 | 320 | 1.0000 | 0.9692 | 0.9844 | 0.0 | 6dfe:A, 2h1f:A, 2h1f:B, 2h1h:A, 2h1h:B |
2 | 7vg5:A | 204 | 29 | 0.0413 | 0.0637 | 0.4483 | 0.24 | 7vg5:B |
3 | 4fgm:A | 587 | 34 | 0.0413 | 0.0221 | 0.3824 | 0.31 | |
4 | 6tm5:P | 492 | 46 | 0.0571 | 0.0366 | 0.3913 | 4.3 | |
5 | 6hiw:DC | 1095 | 53 | 0.0603 | 0.0174 | 0.3585 | 4.9 | |
6 | 3b1n:B | 320 | 78 | 0.0857 | 0.0844 | 0.3462 | 7.3 | 3b1n:A, 3b1p:A, 3b1q:A, 3b1q:B, 3b1q:C, 3b1q:D, 3b1q:E, 3b1q:F, 3b1r:A, 3b1r:B, 3b1r:C, 3b1r:D, 3b1r:E, 3b1r:F |
7 | 8bto:A | 473 | 72 | 0.0603 | 0.0402 | 0.2639 | 9.0 | 8bto:B, 8bto:C, 8bto:D, 8bto:E, 8bto:F, 8bto:G, 8bto:H, 8bto:I, 8bto:J, 8bto:K, 8bto:L, 8btp:A, 8btp:B, 8btp:C, 8btp:D, 8btp:E, 8btp:F, 8btp:G, 8btp:H, 8btp:I, 8btp:J, 8btp:K, 8btp:L, 7uxs:B, 7uxs:A |
8 | 4nv7:B | 270 | 98 | 0.0794 | 0.0926 | 0.2551 | 9.5 | 4nv7:A |