BioLiP

>protein
MRTELLSKLYDDFGIDQLPHTQHGVTSDRLGKLYEKYILDIFKDIESLKKYNTNAFPQEKDISSKLLKALNLDLDNIIDV
SSSDTDLGRTIAGGSPKTDATIRFTFHNQSSRLVPLNIKHSSKKKVSIAEYDVETICTGVGISDGELKELIRKHQNDQSA
KLFTPVQKQRLTELLEPYRERFIRWCVTLRAEKSEGNILHPDLLIRFQVIDREYVDVTIKNIDDYVSDRIAEGSKARKPG
FGTGLNWTYASGSKAKKMQFKG

The query sequence (length=262) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1sa3:A	262	262	1.0000	1.0000	1.0000	0.0	1sa3:B, 1yfi:A, 1yfi:B
2	2cjb:B	495	117	0.1183	0.0626	0.2650	0.26	2cim:A, 2cim:B, 2cj9:A, 2cj9:B, 2cja:A, 2cja:B, 2cjb:A
3	8hkx:AS6E	105	62	0.0725	0.1810	0.3065	0.48	8hky:AS6E, 8hkz:AS6E, 8hl1:AS6E, 8hl2:AS6E, 8hl3:AS6E, 8hl4:AS6E, 8hl5:AS6E, 8wkp:AS6E, 8wq2:AS6E, 8wq4:AS6E
4	6z7o:A	110	69	0.0802	0.1909	0.3043	0.90
5	8bh7:c	208	78	0.0878	0.1106	0.2949	1.6	7aso:B, 7asp:k, 7bge:c, 8bh6:c, 8byv:c, 6fxc:Ac, 6fxc:Bc, 7kwg:c, 5li0:c, 5nd8:c, 5nd9:c, 5ngm:Ac, 7nhl:d, 7nhm:d, 8p2f:d, 8p2g:d, 8p2h:d, 7p48:c, 6s0x:c, 6s13:c, 5tcu:SB, 8y38:c, 8y39:c, 6yef:c
6	4pet:A	329	46	0.0611	0.0486	0.3478	2.1	4pet:B
7	5b2o:A	1455	151	0.1336	0.0241	0.2318	2.2	5b2p:A, 5b2q:A
8	5epl:B	58	48	0.0573	0.2586	0.3125	3.1	5epl:A
9	7uhy:D	288	164	0.1336	0.1215	0.2134	3.3
10	2epn:A	623	61	0.0802	0.0337	0.3443	3.3	2epn:B
11	1n04:A	683	57	0.0573	0.0220	0.2632	7.6	2d3i:A, 8fei:A, 1iej:A, 1iq7:A, 1nft:A, 1nnt:A, 1ovt:A, 8x3h:A
12	3zdu:A	297	51	0.0611	0.0539	0.3137	8.5

[Back]