MRSFLNLNSIPNVAAGNSCSIKLPIGQTYEVIDLRYSGVTPSQIKNVRVELDGRLLSTYKTLNDLILENTRHKRKIKAGV
VSFHFVRPEMKGVNVTDLVQQRMFALGTVGLTTCEIKFDIDEAAAGPKLSAIAQKSVGTAPSWLTMRRNFFKQLNNGTTE
IADLPRPVGYRIAAIHIKAAGVDAVEFQIDGTKWRDLLKKADNDYILEQYGKAVLDNTYTIDFMLEGDVYQSVLLDQMIQ
DLRLKIDSTMDEQAEIIVEYMGVWSRNGF
The query sequence (length=269) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2vvf:A | 269 | 269 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2vvf:B, 2vvf:C, 2vvf:D, 2vvf:E, 2vvf:F, 2w0c:A, 2w0c:B, 2w0c:C, 2w0c:D, 2w0c:E, 2w0c:F, 2w0c:G, 2w0c:H, 2w0c:I, 2w0c:J |
2 | 5ljz:A | 410 | 83 | 0.0855 | 0.0561 | 0.2771 | 1.3 | 5lk1:A |
3 | 8iaq:N | 344 | 53 | 0.0669 | 0.0523 | 0.3396 | 2.3 | 8ib6:N, 8ibb:N, 8ibf:N, 8ic4:N |
4 | 6sh6:A | 681 | 79 | 0.0929 | 0.0367 | 0.3165 | 2.4 | 8ejm:A, 8ro2:DX, 5xdr:A |
5 | 7am2:BQ | 413 | 41 | 0.0669 | 0.0436 | 0.4390 | 4.1 | |
6 | 5m60:A | 755 | 39 | 0.0483 | 0.0172 | 0.3333 | 6.7 | |
7 | 4zw2:A | 319 | 81 | 0.0818 | 0.0690 | 0.2716 | 8.5 |