MRRYRPTNLEPGDAGIYHHEGHRIRLTKDGRCIITCKTVEVYADESMTVDTPRTTFTGDVEIQKGLGVKGKSQFDSNITA
PDAIINGKSTDKHIHRGDSGGTTGPMQL
The query sequence (length=108) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3vto:B | 110 | 108 | 1.0000 | 0.9818 | 1.0000 | 1.22e-77 | 3vto:A, 3vto:C, 3vto:P, 3vto:Q, 3vto:R |
2 | 3aqj:A | 117 | 84 | 0.2870 | 0.2650 | 0.3690 | 3.23e-06 | 3aqj:B, 3aqj:C, 3aqj:P, 3aqj:Q, 3aqj:R, 3qr7:A, 3qr7:B |
3 | 4ru3:A | 205 | 36 | 0.1296 | 0.0683 | 0.3889 | 0.42 | |
4 | 2ik0:B | 286 | 48 | 0.1389 | 0.0524 | 0.3125 | 0.87 | 117e:A, 117e:B, 1e6a:A, 1e6a:B, 1e9g:A, 1e9g:B, 1huj:A, 1huj:B, 1huk:A, 1huk:B, 2ihp:A, 2ihp:B, 2ik0:A, 2ik1:A, 2ik1:B, 2ik2:A, 2ik2:B, 2ik4:A, 2ik4:B, 2ik6:A, 2ik6:B, 2ik7:A, 2ik7:B, 2ik9:A, 1m38:A, 1m38:B, 8prk:A, 8prk:B, 1wgi:A, 1wgi:B, 1wgj:A, 1wgj:B, 1ypp:A, 1ypp:B |
5 | 8f70:A | 567 | 76 | 0.2037 | 0.0388 | 0.2895 | 2.9 | 8f5n:A, 6n0a:A, 6n0a:B |
6 | 8f70:A | 567 | 76 | 0.2037 | 0.0388 | 0.2895 | 2.9 | 8f5n:A, 6n0a:A, 6n0a:B |
7 | 1o12:A | 363 | 55 | 0.1574 | 0.0468 | 0.3091 | 4.9 | 1o12:B |
8 | 6t5e:A | 439 | 44 | 0.1389 | 0.0342 | 0.3409 | 5.0 | |
9 | 5yeu:A | 381 | 26 | 0.1019 | 0.0289 | 0.4231 | 6.1 | 5yeu:B |
10 | 1rm6:A | 761 | 28 | 0.0926 | 0.0131 | 0.3571 | 7.4 | 1rm6:D, 1sb3:A, 1sb3:D |
11 | 1qz3:A | 309 | 47 | 0.1389 | 0.0485 | 0.3191 | 9.0 |