MRPVLVLLHRYVGLATALFLFLAGLTGSLLAFHHEIDEWLNPGFYAVGEGGERLSPGSLVQRVESRYPRQLVWYMEYPEA
GGHPALLATVPREAGAKVEHDVFYLDPVSGEEVGKRLWAACCFQPANLVPWVLEFHHNLTLPGNWGLYLMGGVAMFWFLD
CFVGAWLTLPRNAYRFNFDLHRAGGLWLWLLLAPVALSSVALNLPSQVFKPLVSLFSPIEPSVYEARGRLPREQLGETRL
DYDRTFQLASVEAARLGIAEPIGELYYSFEYNFFGAGFGDHDDPMGKSWLFFHGSDGRLLGQEVAGQGSWGERFYRLQYP
IHGGRIAGLPGRIAIAALGLAIAGLSLTGVYIWWRKRRARHWNGR
The query sequence (length=365) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7abw:B | 365 | 365 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7abw:A |
2 | 2bgg:B | 394 | 110 | 0.0685 | 0.0635 | 0.2273 | 1.1 | 2w42:B |
3 | 8ok9:A | 430 | 110 | 0.0685 | 0.0581 | 0.2273 | 1.1 | 2bgg:A, 8pvv:A, 8qg0:A, 6t5t:A, 6tuo:A, 2w42:A, 6xu0:A, 6xu0:B, 6xup:A, 6xup:B, 1ytu:A, 1ytu:B |
4 | 5h6j:B | 222 | 45 | 0.0466 | 0.0766 | 0.3778 | 1.5 | 5h6j:A, 5h6l:A, 5h6l:B |
5 | 1uky:A | 196 | 70 | 0.0685 | 0.1276 | 0.3571 | 4.9 | 1ukz:A |
6 | 4aq0:A | 765 | 120 | 0.0904 | 0.0431 | 0.2750 | 7.3 | 4aq0:B, 2xsg:A, 2xsg:B |