MRPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMAIRLGRYFDTSAQFWMNLQSEYSLATAYAA
NGKQIEHEIE
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7csy:B | 97 | 90 | 1.0000 | 0.9278 | 1.0000 | 6.65e-64 | 7csw:B, 7csy:A, 7csy:C, 7csy:D, 6jpi:A, 6jpi:B, 6jpi:C, 6jpi:D, 6lb3:A, 6lb3:B, 6lb3:G, 6lb3:H, 6lb3:C, 6lb3:D, 6lb3:E, 6lb3:F |
2 | 6fix:B | 99 | 85 | 0.5556 | 0.5051 | 0.5882 | 4.45e-32 | 6fix:A, 6fix:D, 6fix:E |
3 | 2icp:A | 87 | 73 | 0.2778 | 0.2874 | 0.3425 | 1.47e-09 | |
4 | 6chv:D | 91 | 87 | 0.2667 | 0.2637 | 0.2759 | 1.04e-06 | 6chv:A, 6chv:C, 6chv:B, 6chv:G, 6chv:H |
5 | 7tbv:A | 682 | 51 | 0.1778 | 0.0235 | 0.3137 | 0.30 | 7tbv:B, 7tbv:C, 7tbv:D |
6 | 2fva:A | 82 | 54 | 0.1667 | 0.1829 | 0.2778 | 0.69 | |
7 | 7shw:B | 259 | 42 | 0.1444 | 0.0502 | 0.3095 | 4.3 | 7shw:A |