BioLiP

>protein
MRNEMHLQFSARSENESFARVTVAAFVAQLDPTMDELTEIKTVVSEAVTNAIIHGYNNDPNGIVSISVIIEDGVVHLTVR
DEGVGIPDIEEARQPLERSGMGFTIMENFMDEVIVESEVNKGTTVYLKKHGI

The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1l0o:A	141	137	0.9848	0.9220	0.9489	2.83e-90	1l0o:B, 1th8:A, 1thn:A, 1thn:C, 1tid:A, 1tid:C, 1til:A, 1til:C, 1til:E
2	4r3a:A	318	86	0.2045	0.0849	0.3140	1.26e-04	4r38:A, 4r38:B, 4r38:C, 4r38:D, 4r39:A, 4r39:B, 4r39:C, 4r39:D
3	4jav:A	246	117	0.2348	0.1260	0.2650	2.14e-04	6azr:A, 6azr:C, 2c2a:A, 3dge:A, 3dge:B, 4jas:A, 4jau:A, 4jav:B, 6rfv:A, 6rfv:B, 6rgy:A, 6rgy:B, 6rgz:A, 6rgz:B, 6rh0:A, 6rh0:B, 6rh1:A, 6rh1:B, 6rh2:A, 6rh2:B, 6rh7:A, 6rh7:B, 6rh8:A, 6rh8:B, 5uht:A, 5uht:C
4	3sl2:A	145	115	0.2500	0.2276	0.2870	0.003
5	3ke6:A	354	80	0.1742	0.0650	0.2875	0.004	3ke6:B
6	4r3a:B	278	88	0.2121	0.1007	0.3182	0.012
7	3d36:B	221	93	0.1970	0.1176	0.2796	0.019	3d36:A
8	8sbm:B	126	73	0.1667	0.1746	0.3014	0.069	8sbm:A, 3zxo:A, 3zxo:B
9	2qyv:A	472	65	0.1667	0.0466	0.3385	0.36	2qyv:B
10	2ml2:A	161	45	0.1061	0.0870	0.3111	2.1
11	6ikg:A	644	70	0.1288	0.0264	0.2429	4.0	6ikg:B
12	7wae:B	877	32	0.0985	0.0148	0.4062	5.1	7wad:A, 7wad:B, 7wad:C, 7wad:D, 7wae:D, 7wae:A, 7wae:C, 7waf:A, 7waf:C, 7waf:D, 7waf:B
13	4k0b:A	404	48	0.1136	0.0371	0.3125	9.5	4k0b:B, 4l2z:A, 4l2z:B, 4l7i:A, 4l7i:B

[Back]