MRLRISEAVVLFLLGAVAALIGDHSHVVTGTTVYHTDAVPFVWSSPFWFPILVGAATASLAELRLHLPAPRDGVTARQAL
GGVAAVVGTYVTTALVHAFPVVPVTALVCAAAAITWCVLGDGPGAACGVVIAVIGPAVEIALVQLGVFAYHPDSDGLFGV
APFLAPLYFAFGVVAALLGELAVARRPQL
The query sequence (length=189) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4xu5:A | 189 | 189 | 1.0000 | 1.0000 | 1.0000 | 1.57e-129 | 4xu6:A |
2 | 7etw:A | 197 | 181 | 0.2434 | 0.2335 | 0.2541 | 4.44e-04 | 6m49:A |
3 | 4ce5:A | 325 | 46 | 0.0952 | 0.0554 | 0.3913 | 0.90 | 4ce5:B, 8x1f:A, 8x1f:B, 7xg5:A, 7xg5:B, 8xiy:A, 8xiy:B |
4 | 6snl:D | 320 | 67 | 0.1217 | 0.0719 | 0.3433 | 1.2 | 6snl:A, 6snl:B, 6snl:C, 6snl:E, 6snl:F |
5 | 6xwb:A | 319 | 42 | 0.0899 | 0.0533 | 0.4048 | 3.2 | 6xwb:B |
6 | 2d3m:A | 405 | 86 | 0.1376 | 0.0642 | 0.3023 | 3.4 | 2d3m:B, 2d52:A, 2d52:B |