BioLiP

>protein
MRLEQLQAFLAIAETGSFQKAASKCGVTQSTISRQIQSLEADLGLELFHRTNHSKLTLGGERLLPRARKICLEWETATQE
LGDLIAGKQPELCIAAIHSLCGSYLPPVLQKFCRDYPEVQLRVTSLGSDRALKVLKDGLVDLAIVMNNRFLTTGRDMVVE
VLYDEPIELLTAANHPLAAYERVPWSELVRYPQVVFKDGYGMQRLVQEKFERLEATLQAALEVNTLDAFRGVVRQGELIA
LLPSSALVEARLDPTLAVRPLALTRRVVMVTTQDRLQIPPIKHFWQLVRENIPP

The query sequence (length=294) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8h3v:S	304	303	1.0000	0.9671	0.9703	0.0	8h3v:T, 8h3v:U, 8h3v:V
2	5y2v:A	304	247	0.2245	0.2171	0.2672	5.12e-20	5y2v:B, 5y2v:C, 5y2v:D, 5y2w:A
3	9f14:A	324	259	0.2143	0.1944	0.2432	3.98e-16	9f14:B, 9fdd:A, 9fdd:B, 9fdd:C, 9fdd:D, 9fdd:E, 9fdd:F, 9fdd:G, 9fdd:H, 4lq2:A, 4lq5:A, 4m4g:A
4	6g4r:B	322	256	0.2245	0.2050	0.2578	1.10e-14	6g1b:J, 6g4r:E
5	3fxr:A	296	254	0.2211	0.2196	0.2559	1.82e-12	3fxu:A, 3fxu:B, 3n6u:A
6	5z49:B	220	153	0.1156	0.1545	0.2222	5.33e-09	5z49:A
7	7d98:Q	288	153	0.1667	0.1701	0.3203	2.08e-08	7d98:A, 7d98:B, 7d98:P, 5xxp:A, 5xxp:B
8	6xtv:B	290	110	0.1224	0.1241	0.3273	4.99e-08
9	4ihs:B	93	50	0.0816	0.2581	0.4800	1.09e-07	4ihs:A, 4ihs:C, 4ihs:D, 4iht:A, 4iht:B, 4iht:C, 4iht:D
10	8y6u:H	92	80	0.1122	0.3587	0.4125	4.78e-07	8y6u:J
11	3hfu:B	204	194	0.1361	0.1961	0.2062	5.38e-07	3hfu:A, 3hfu:C, 3hfu:D
12	7w06:A	207	88	0.0918	0.1304	0.3068	2.43e-05	7w07:A
13	3glb:D	219	158	0.1224	0.1644	0.2278	8.89e-05	2f7c:A, 3glb:A, 3glb:B, 3glb:C
14	5ted:B	210	190	0.1224	0.1714	0.1895	1.21e-04	5ted:A
15	7xro:B	207	86	0.0782	0.1111	0.2674	0.008
16	5vvi:A	208	52	0.0578	0.0817	0.3269	0.038	5vvi:B, 5vvi:C
17	1twy:A	249	43	0.0510	0.0602	0.3488	0.064
18	7erp:B	199	152	0.1020	0.1508	0.1974	0.072	7erp:A, 7erp:C, 7erp:D
19	7dmw:A	200	157	0.1190	0.1750	0.2229	0.11	7dmw:B, 7dmw:C, 7dmw:D, 7dmw:E
20	9bh5:CI	213	45	0.0476	0.0657	0.3111	1.1	9cai:CI
21	8ftm:B	731	38	0.0544	0.0219	0.4211	2.4	8ftm:A
22	8fth:A	1263	38	0.0544	0.0127	0.4211	2.7
23	4q8r:A	241	88	0.0816	0.0996	0.2727	2.7
24	7t30:A	666	74	0.0544	0.0240	0.2162	4.1	7t2r:A, 7t2r:F, 7t30:F
25	7ak5:O	320	105	0.0918	0.0844	0.2571	5.1	7ak6:O, 7b93:O, 8c2s:O, 8ca3:O, 8ca5:O, 6g2j:O, 6g72:O, 8iao:O, 8iaq:O, 8ib4:O, 8ib6:O, 8ib9:O, 8ibb:O, 8ibd:O, 8ibf:O, 8ic2:O, 8ic4:O, 8olt:O, 8om1:O, 7psa:O, 8pw5:O1, 8pw6:O1, 8pw7:O1, 8rgp:O, 8rgq:O, 8rgr:O, 8rgt:O, 6zr2:O, 6ztq:O
26	8p5d:LI0	217	45	0.0442	0.0599	0.2889	5.2	8p60:LI0, 8p60:KI0, 7qca:LI0
27	2f7a:B	213	172	0.1122	0.1549	0.1919	5.2
28	3ssn:B	350	136	0.1054	0.0886	0.2279	6.4
29	5jj5:A	308	47	0.0510	0.0487	0.3191	7.2	4hmq:A, 4hmq:B, 5jj5:B
30	1s20:G	335	68	0.0714	0.0627	0.3088	8.8	1s20:A, 1s20:B, 1s20:C, 1s20:D, 1s20:E, 1s20:F, 1s20:H

[Back]