MRLEIPNHTERFGVVRLHEVQRILELDSGRVRDESPAVGLRRLDDADLRDVLEQTAIVVPTRNERLKLLEGVLSGIPHEA
The query sequence (length=391) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
2wvk:A |
391 |
391 |
1.0000 |
1.0000 |
1.0000 |
0.0 |
2wvk:B, 2wvl:A, 2wvl:B, 2wvm:A, 2wvm:B |
2 |
2zu8:A |
373 |
388 |
0.4271 |
0.4477 |
0.4304 |
1.56e-113 |
2zu8:B, 2zu9:B, 2zu9:A |
3 |
7c3k:B |
389 |
85 |
0.0486 |
0.0488 |
0.2235 |
0.15 |
7c3k:A, 8jqz:A, 8jqz:B |
4 |
4dec:A |
284 |
148 |
0.1176 |
0.1620 |
0.3108 |
0.46 |
4de7:A, 3e25:A, 5jsx:A, 5jt0:A, 5juc:A, 5jud:A, 4y6n:A, 4y6u:A, 4y7f:A, 4y7g:A, 4y9x:A |
5 |
6qfb:C |
1011 |
27 |
0.0332 |
0.0129 |
0.4815 |
0.76 |
|
6 |
5xla:A |
490 |
128 |
0.0767 |
0.0612 |
0.2344 |
0.77 |
3eyk:B, 5xl3:B, 5xl3:A, 5xl4:A, 5xl4:B, 5xl6:A, 5xl7:A, 5xl7:B, 5xl9:A, 5xla:B, 5xlc:A, 5xlc:B, 5xld:A, 5xld:B |
7 |
7vex:A |
412 |
109 |
0.0691 |
0.0655 |
0.2477 |
0.79 |
8h4m:A |
8 |
8g1e:A |
1037 |
27 |
0.0332 |
0.0125 |
0.4815 |
0.83 |
8g1e:B, 8g1e:D, 8g1e:C, 8g1f:A, 8g1f:C, 8g1f:B, 8g1f:D, 8g5c:A, 8g5c:B, 8g5c:C, 8g5c:D, 8g5d:A, 8g5d:B, 8g5d:C, 8g5d:D, 6hxh:A, 6hxh:B, 6hxh:C, 6hxh:D, 6hxh:E, 6hxh:F, 6hxh:G, 6hxh:H, 6hxk:A, 6hxk:B, 6hxk:C, 6hxk:D, 6hxl:A, 6hxl:B, 6hxl:C, 6hxl:D, 6hxl:E, 6hxl:F, 6hxl:G, 6hxl:H, 6hxm:A, 6hxm:B, 7liw:B, 7liw:D, 7lj9:A, 7lj9:B, 7lj9:C, 7lj9:D, 7lla:A, 7lla:C, 7lla:B, 7lla:D, 3mwe:A, 6o0h:A, 6o0h:B, 6o0h:C, 6o0h:D, 3pff:A, 6poe:B, 6poe:D, 6poe:A, 6poe:C, 6qfb:A, 6qfb:B, 6qfb:D, 7rig:A, 7rig:C, 7rig:B, 7rig:D, 7rkz:A, 7rkz:C, 7rkz:B, 7rkz:D, 7rmp:A, 7rmp:C, 7rmp:B, 7rmp:D, 5tde:A, 5tde:B, 5tdf:A, 5tdm:A, 5tdm:B, 5tdz:A, 5te1:A, 5te1:B, 5teq:A, 5teq:B, 5tes:A, 5tet:A, 6ui9:A, 6ui9:C, 6ui9:B, 6ui9:D, 6uia:C, 6uia:A, 6uia:D, 6uia:B, 6uuw:A, 6uuw:C, 6uuw:B, 6uuw:D, 6uuz:A, 6uuz:C, 6uuz:B, 6uuz:D, 6uv5:A, 6uv5:C, 6uv5:B, 6uv5:D, 6z2h:A, 6z2h:C, 6z2h:D |
9 |
6u7j:A |
569 |
60 |
0.0460 |
0.0316 |
0.3000 |
0.93 |
6u7j:C, 6u7j:D |
10 |
4wa2:A |
491 |
127 |
0.0793 |
0.0631 |
0.2441 |
0.98 |
6bkq:A, 6bkq:C, 6bkq:E, 6cex:A, 6cex:C, 6cex:E, 1mqm:A, 1mqm:D, 1mqm:G, 1mqn:A, 1mqn:D, 5t6n:A, 5t6n:E, 5t6n:C, 6tzb:A, 6tzb:C, 6tzb:E, 2vir:C, 2vis:C, 2vit:C, 5vtq:A, 5vtq:C, 5vtq:E, 5vtr:A, 5vtr:C, 5vtr:E, 5vtv:A, 5vtv:C, 5vtv:E, 5vtw:C, 5vtw:E, 5vtw:A, 5vty:A, 5vty:C, 5vty:E, 5vu4:A, 5vu4:C, 5vu4:E, 4wa2:B, 4wa2:C, 4wa2:E, 6y5j:E, 2ypg:A, 2ypg:C, 2ypg:E |
11 |
7pkt:x |
167 |
74 |
0.0563 |
0.1317 |
0.2973 |
1.4 |
|
12 |
8p5d:LD0 |
281 |
36 |
0.0384 |
0.0534 |
0.4167 |
5.6 |
8p60:LD0, 8p60:KD0, 7qca:LD0 |
13 |
6bbm:A |
405 |
74 |
0.0563 |
0.0543 |
0.2973 |
6.6 |
|
14 |
5ftx:A |
651 |
35 |
0.0332 |
0.0200 |
0.3714 |
7.4 |
5fty:A, 5fty:B, 4uie:A, 4uj7:A, 4uj8:A, 4uj8:B, 4uj8:C, 4uj8:D |
15 |
5dx5:A |
399 |
100 |
0.0767 |
0.0752 |
0.3000 |
7.9 |
5dx5:B |
16 |
3hvo:A |
559 |
36 |
0.0332 |
0.0233 |
0.3611 |
9.0 |
3hvo:B |