BioLiP

>protein
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVG
YFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIRAAFARITLPLARALLRIGLTPDAV
TIIGTTASVAGALVLFPMGKLFPGACVVWFFVLFDMLDGAMARLRSGGTRFGAVLDAACDRISDGAVFSGLLWWIAFGMR
DRLLVVATLTCLVTSQVISYIKARAEASGLRGDGGIIERPERLIIVLVGAGVSDFPFIAWPPALPVAMWVLAVASVITLG
QRLHTVWTSPGATDRI

The query sequence (length=336) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6wm5:A	337	337	1.0000	0.9970	0.9970	0.0	6wm5:C, 6wmv:A, 6wmv:C
2	5d92:D	342	335	0.6548	0.6433	0.6567	2.13e-141	5d91:A, 5d92:A, 5d92:B, 5d92:C
3	6h5a:B	209	195	0.5000	0.8038	0.8615	6.77e-117	6h59:A, 6h59:B, 6h5a:A
4	4o6m:B	341	244	0.4762	0.4692	0.6557	6.62e-100	4o6m:A, 4o6n:A, 4o6n:B, 4q7c:A, 4q7c:B
5	8gyw:B	380	79	0.0565	0.0500	0.2405	0.029	8gyw:A, 8gyx:B, 8gyx:A
6	7pow:B	204	47	0.0506	0.0833	0.3617	0.25	7b1k:A, 7b1k:B, 7b1l:A, 7b1l:B, 7b1n:A, 7b1n:B, 7pow:A
7	8ero:A	364	79	0.0595	0.0549	0.2532	0.44	8ero:B, 8erp:B, 8erp:A
8	2etz:A	108	34	0.0476	0.1481	0.4706	3.8	2eu0:A
9	6pdq:D	142	29	0.0327	0.0775	0.3793	4.2	6pdq:A
10	7ouf:E	278	50	0.0446	0.0540	0.3000	8.1	7ouf:B, 7oug:E, 7oug:B, 7ouh:E, 7ouh:B, 7pel:B, 7pel:E
11	1q9u:B	128	61	0.0565	0.1484	0.3115	9.7
12	4mnd:A	408	122	0.0804	0.0662	0.2213	10.0

[Back]