BioLiP

>protein
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVG
YFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSRGLFAAIFLPIARLLADWGVSPD
AVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVIWFFLG
GANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIASVVTIF
QRVLTVREQAKAWTA

The query sequence (length=335) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5d92:D	342	342	1.0000	0.9795	0.9795	0.0	5d91:A, 5d92:A, 5d92:B, 5d92:C
2	6wm5:A	337	328	0.6687	0.6647	0.6829	2.40e-148	6wm5:C, 6wmv:A, 6wmv:C
3	4o6m:B	341	349	0.5761	0.5660	0.5530	8.23e-107	4o6m:A, 4o6n:A, 4o6n:B, 4q7c:A, 4q7c:B
4	6h5a:B	209	191	0.2448	0.3923	0.4293	8.46e-38	6h59:A, 6h59:B, 6h5a:A
5	4mnd:A	408	214	0.1642	0.1348	0.2570	3.79e-05
6	6m53:B	339	100	0.0836	0.0826	0.2800	1.0	7bp1:A, 7bp1:C, 7bp1:D, 7bpc:A, 7bpc:C, 6m53:A, 6m53:C, 6m53:D
7	8wcn:A	379	139	0.1045	0.0923	0.2518	2.6	8wcn:B
8	2etz:A	108	36	0.0507	0.1574	0.4722	4.1	2eu0:A
9	6pdq:D	142	29	0.0328	0.0775	0.3793	6.5	6pdq:A
10	8gyw:B	380	165	0.1104	0.0974	0.2242	7.4	8gyw:A, 8gyx:B, 8gyx:A
11	7pkt:b	304	29	0.0388	0.0428	0.4483	8.7
12	5fl7:H	113	58	0.0448	0.1327	0.2586	9.0

[Back]