BioLiP

>protein
MRLAYVKNHEIYGEKLLGLTLRERIEKTLQRAGFDVRFFDELSLEEAEDYLIILEPVLILERDLLLEGRKILVSDGFTVG
YFFGGDFRTVFDGNLQSSIEKYLSLNNLESYEIWAIKLSNDNLKTAEKLLLSSLIGSGSKYARGLFAAIFLPIARLLADW
GVSPDAVTVVGTLGVMAGALIFYPMGQLFWGTVVITVFVFSDIIDGLMARLLFREGPWGAFLDSYLDRVGDSSVFTGIVI
WFFLGGANPTIAILALICLVLSSLVSYSKARAEGLGLTANVGIAERSERLVVVLVATGLVGLGIPSWVLLVVLIVLAIAS
VVTIFQRVLTVREQAKAWTA

The query sequence (length=340) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5d92:D	342	342	1.0000	0.9942	0.9942	0.0	5d91:A, 5d92:A, 5d92:B, 5d92:C
2	6wm5:A	337	333	0.6559	0.6617	0.6697	3.44e-147	6wm5:C, 6wmv:A, 6wmv:C
3	4o6m:B	341	349	0.5706	0.5689	0.5559	3.99e-107	4o6m:A, 4o6n:A, 4o6n:B, 4q7c:A, 4q7c:B
4	6h5a:B	209	185	0.2382	0.3876	0.4378	8.12e-38	6h59:A, 6h59:B, 6h5a:A
5	4mnd:A	408	215	0.1618	0.1348	0.2558	2.57e-05
6	6m53:B	339	100	0.0824	0.0826	0.2800	0.94	7bp1:A, 7bp1:C, 7bp1:D, 7bpc:A, 7bpc:C, 6m53:A, 6m53:C, 6m53:D
7	7pkt:b	304	46	0.0500	0.0559	0.3696	2.7
8	8gyw:B	380	213	0.1412	0.1263	0.2254	4.3	8gyw:A, 8gyx:B, 8gyx:A
9	6xyw:Ac	218	107	0.1059	0.1651	0.3364	4.3
10	6pdq:D	142	29	0.0324	0.0775	0.3793	6.7	6pdq:A
11	8wcn:A	379	38	0.0382	0.0343	0.3421	8.3	8wcn:B

[Back]