MRHYDCKNYINLDCEKGLCALTKGMVPIDGEGSEACPNFKPAEKCGNCKNFCNPDKYGLGTCTGLEKENWAYATCGASAC
PSYKAE
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2y8n:B | 86 | 86 | 1.0000 | 1.0000 | 1.0000 | 8.49e-60 | 2y8n:D, 2yaj:B, 2yaj:D |
2 | 6uy4:A | 354 | 24 | 0.1279 | 0.0311 | 0.4583 | 0.69 | |
3 | 2jsd:A | 160 | 35 | 0.1395 | 0.0750 | 0.3429 | 2.2 | |
4 | 8f9y:A | 352 | 27 | 0.1395 | 0.0341 | 0.4444 | 6.1 | |
5 | 2mze:A | 250 | 51 | 0.1628 | 0.0560 | 0.2745 | 7.3 | 2ddy:A, 8jud:A, 8juf:A, 8jug:A, 8k4z:A, 1mmp:A, 1mmp:B, 1mmq:A, 1mmr:A, 2mzh:A, 2mzi:A, 5ue2:A, 5ue5:A, 7wxx:A, 2y6c:A, 2y6d:A |
6 | 6eor:B | 805 | 33 | 0.1163 | 0.0124 | 0.3030 | 9.4 | 6qzv:B |