MRERTEARRRRIEEVLRRRQPDLTVLLENVHKPHNLSAILRTCDAVGVLEAHAVNPTGGVPTFNETSGGSHKWVYLRVHP
DLHEAFRFLKERGFTVYATALREDARDFREVDYTKPTAVLFGAEKWGVSEEALALADGAIKIPMLGMVQSLNVSVAAAVI
LFEAQRQRLKAGLYDRPRLDPELYQKVLADW
The query sequence (length=191) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1v2x:A | 191 | 191 | 1.0000 | 1.0000 | 1.0000 | 2.87e-141 | |
2 | 7edc:A | 236 | 182 | 0.5288 | 0.4280 | 0.5549 | 7.12e-64 | |
3 | 4x3l:A | 260 | 150 | 0.3141 | 0.2308 | 0.4000 | 3.31e-15 | 4x3l:B, 4x3m:A, 4x3m:B |
4 | 5kzk:A | 262 | 151 | 0.2565 | 0.1870 | 0.3245 | 5.04e-13 | 5kzk:B, 5l0z:A, 5l0z:B |
5 | 2ha8:A | 159 | 151 | 0.2094 | 0.2516 | 0.2649 | 1.37e-12 | 2ha8:B |
6 | 5co4:B | 161 | 161 | 0.3089 | 0.3665 | 0.3665 | 1.03e-11 | 5co4:A |
7 | 1x7p:A | 265 | 161 | 0.2565 | 0.1849 | 0.3043 | 1.79e-09 | 1x7p:B |
8 | 4pzk:A | 159 | 158 | 0.2670 | 0.3208 | 0.3228 | 6.97e-09 | 4pzk:B |
9 | 8w9u:A | 152 | 147 | 0.2147 | 0.2697 | 0.2789 | 2.21e-08 | 8w9u:B |
10 | 7oi6:1 | 257 | 162 | 0.2356 | 0.1751 | 0.2778 | 2.43e-08 | 7oi6:z |
11 | 3nk7:B | 267 | 142 | 0.2147 | 0.1536 | 0.2887 | 4.12e-06 | 3nk7:A |
12 | 3gyq:A | 261 | 166 | 0.2356 | 0.1724 | 0.2711 | 6.60e-06 | 3gyq:B |
13 | 7e3q:B | 159 | 139 | 0.1937 | 0.2327 | 0.2662 | 8.04e-06 | |
14 | 4jal:A | 156 | 150 | 0.2042 | 0.2500 | 0.2600 | 5.97e-04 | 4jal:B |
15 | 4kgn:C | 157 | 154 | 0.2199 | 0.2675 | 0.2727 | 0.001 | 4kgn:E, 4kgn:G |
16 | 1mxi:A | 156 | 150 | 0.1937 | 0.2372 | 0.2467 | 0.002 | |
17 | 3n4k:A | 163 | 153 | 0.2199 | 0.2577 | 0.2745 | 0.002 | |
18 | 4cng:A | 156 | 143 | 0.1728 | 0.2115 | 0.2308 | 0.004 | 4cnf:A, 4cng:B |
19 | 4kgn:A | 139 | 150 | 0.2094 | 0.2878 | 0.2667 | 0.009 | |
20 | 4xbo:A | 228 | 48 | 0.0838 | 0.0702 | 0.3333 | 2.5 | 4cne:A, 4cne:B, 4xbo:B |
21 | 6fxr:A | 700 | 116 | 0.1466 | 0.0400 | 0.2414 | 3.1 | 6fxk:A, 6fxm:A, 6fxt:A, 6fxx:A, 6fxy:A, 8one:A, 6te3:A, 6tec:A, 6tes:A, 6teu:A, 6tex:A, 6tez:A, 6wfv:A |
22 | 1cjx:A | 352 | 53 | 0.0890 | 0.0483 | 0.3208 | 3.6 | 1cjx:D, 1cjx:B, 1cjx:C, 7x8e:A, 7x8e:B, 7x8e:C, 7x8e:D, 7x8e:E, 7x8e:F, 7x8e:G, 7x8e:H, 7xnt:G, 7xnt:A, 7xnt:B |
23 | 7z79:B | 306 | 65 | 0.1099 | 0.0686 | 0.3231 | 7.6 | 7z79:A, 7z79:C, 7z79:D, 7z79:E, 7z79:F |
24 | 5gm8:B | 173 | 163 | 0.2042 | 0.2254 | 0.2393 | 8.0 | 5gm8:A, 5gm8:C, 5gm8:D |
25 | 1yag:A | 372 | 25 | 0.0576 | 0.0296 | 0.4400 | 9.2 | 8a5a:V, 8a5d:V, 8a5o:V, 8a5p:V, 8a5q:V, 5i9e:D, 5nbl:C, 5nbl:D, 5nbm:C, 5nbm:D, 5nbn:C, 5nbn:D, 8thx:A, 8thx:B, 8thx:C, 8thx:D, 8thx:E, 8thy:A, 8thy:B, 8thy:C, 8thy:D, 8thy:E, 8ti3:A, 8ti3:B, 8ti3:C, 8ti3:D, 8ti3:E, 7vvy:G, 7vvz:G, 1yvn:A |
26 | 4pl7:A | 382 | 25 | 0.0576 | 0.0288 | 0.4400 | 9.6 | 4pl7:B, 7zvw:B |