MRDPFMEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGPAVALSCRMDYFRPLGAGARV
EARAVEVNLSRRTATYRVEVVSEGKLVALFTGTVFRL
The query sequence (length=117) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1wlv:A | 117 | 117 | 1.0000 | 1.0000 | 1.0000 | 5.23e-81 | 1wlv:C, 1wlv:D, 1wlv:B, 1wlv:E, 1wlv:F, 1wlv:G, 1wlv:H, 1wn3:A, 1wn3:C, 1wn3:D, 1wn3:B, 1wn3:E, 1wn3:G, 1wn3:H, 1wn3:F |
2 | 5hmc:A | 125 | 111 | 0.3333 | 0.3120 | 0.3514 | 3.01e-10 | |
3 | 3f5o:A | 138 | 110 | 0.2821 | 0.2391 | 0.3000 | 4.18e-06 | 3f5o:B, 3f5o:C, 3f5o:D, 3f5o:E, 3f5o:F, 3f5o:G, 3f5o:H |
4 | 3lbe:B | 124 | 73 | 0.2051 | 0.1935 | 0.3288 | 5.56e-06 | 3lbe:A, 3lbe:C, 3lbe:D |
5 | 4zrb:E | 128 | 121 | 0.2735 | 0.2500 | 0.2645 | 1.06e-05 | 4zrb:A, 4zrb:D, 4zrb:B, 4zrb:C, 4zrb:G, 4zrb:H, 4zrb:F |
6 | 1q4s:A | 142 | 112 | 0.2479 | 0.2042 | 0.2589 | 0.76 | 1q4s:B, 1q4t:A, 1q4t:B, 1q4u:A, 1q4u:B, 3r32:A, 3r32:B, 3r34:A, 3r34:B, 3r35:A, 3r35:B, 3r37:A, 3r37:B, 3r3a:A, 3r3a:B, 3r3b:A, 3r3b:B, 3r3c:A, 3r3c:B, 3r3d:A, 3r3d:B, 3r3f:A, 3r3f:B, 3tea:A, 3tea:B |
7 | 9fcf:A | 265 | 29 | 0.1026 | 0.0453 | 0.4138 | 1.9 | 9fcg:A |
8 | 7cz3:A | 168 | 91 | 0.2137 | 0.1488 | 0.2747 | 7.9 | 7cz3:B, 7cz3:C, 7cz3:D, 7cz3:E, 7cz3:F |