BioLiP

>protein
MQYKLILNGKTLKGCTTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE

The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2i2y:A	150	56	0.9821	0.3667	0.9821	2.79e-33	9asq:H, 5bmg:A, 5bmg:B, 5bmg:H, 5bmg:D, 5bmg:E, 5bmg:F, 5bmg:G, 5bmh:A, 3v3x:C, 3v3x:D
2	5o94:A	56	56	0.8393	0.8393	0.8393	1.92e-29	5ofs:A, 5ofs:B, 5ofs:C, 5ofs:D
3	6nl8:A	56	56	0.8750	0.8750	0.8750	1.66e-28	6nla:A
4	7rxc:B	439	54	0.8393	0.1071	0.8704	7.14e-26	7rxd:B
5	5lde:B	225	53	0.7679	0.1911	0.8113	3.86e-20	5lde:A
6	6nl6:B	56	56	0.7500	0.7500	0.7500	2.24e-18	6nl6:C, 6nl6:D, 6nl7:B
7	8jxr:C	341	54	0.5714	0.0938	0.5926	2.42e-10
8	7nrr:AAA	329	32	0.2500	0.0426	0.4375	0.69	7nrr:BBB, 7nsw:AAA, 7nsw:BBB, 7ntd:AAA, 7ntd:BBB, 7nte:A, 7nte:B
9	6dft:F	321	23	0.1607	0.0280	0.3913	2.4	6dft:B, 6dft:D, 6dft:H, 6dft:J, 6dft:L
10	8khn:A	287	33	0.2143	0.0418	0.3636	3.3	8kho:A
11	7epq:A	296	30	0.1786	0.0338	0.3333	6.6	7epq:B
12	8hl1:AEFG	725	52	0.2857	0.0221	0.3077	7.1	8hl2:AEFG, 8hl3:AEFG, 8hl4:AEFG
13	7puk:A	425	28	0.1964	0.0259	0.3929	7.1	7puj:A, 7puk:C
14	4l9o:A	330	14	0.1607	0.0273	0.6429	7.4	4l9o:B
15	4zoh:C	161	23	0.2143	0.0745	0.5217	7.5
16	7esn:A	435	32	0.2143	0.0276	0.3750	7.8	7esk:A, 7esm:A, 8i4d:A, 7yqs:A
17	7wkp:A	167	25	0.1607	0.0539	0.3600	8.5	8k0k:I, 8k22:H, 8k23:H, 8k23:h, 8k24:h, 8k24:H, 8k27:I, 8k28:I, 8k29:I, 7wwu:I
18	5mcp:F	342	35	0.2143	0.0351	0.3429	8.9
19	6t69:A	205	42	0.3214	0.0878	0.4286	9.1

[Back]