BioLiP

>protein
MQWSGARALEALLTVAGELRGPPLQLDTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLNLTPEQVVAIASHDGGKQALET
VQRLLPVLCQAHGLTPQQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQALLPVLCQAH
GLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPQQVVAIAS
RGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPQQVVAIASHDGGKQALETVQR
LLPVLCQAHGLTPQQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLT
PEQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPQQVVAIASNGGGRPALESIVAQLSRPDPALAALTNDHLVALACLG
GRPALDAVKKLEH

The query sequence (length=493) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4gjp:A	497	494	0.9939	0.9859	0.9919	0.0	4gg4:A, 4gjp:B, 4gjr:A, 6jtq:A, 6jtq:B, 6jvz:A, 6jvz:B, 6jw0:A, 6jw0:B, 6jw1:A, 6jw1:B, 6jw2:A, 6jw2:B, 6jw2:E, 6jw2:H, 6jw3:A, 6jw3:B, 6jw3:E, 6jw3:H, 6jw4:A, 6jw4:B, 6jw4:E, 6jw4:H, 6jw5:A, 6jw5:B, 6jw5:E, 6jw5:H, 6lew:A, 4osh:B, 4osh:A, 4osi:A, 4osj:A, 4osj:B, 4osk:A, 4osk:B, 4osl:A, 4osl:B, 4osm:A, 4osm:B, 4osq:A, 4osr:A, 4oss:A, 4ost:B, 4ost:A, 4osv:A, 4osw:A, 4osz:B, 4osz:A, 4ot0:A, 4ot0:B, 4ot3:B, 4ot3:A, 4oto:A, 3v6t:A
2	2ypf:A	675	495	0.8925	0.6519	0.8889	0.0	4gjr:B, 6lew:B, 4osi:B, 4osq:B, 4osr:B, 4oss:B, 4osv:B, 4osw:B, 4oto:B, 3v6t:B
3	2ypf:A	675	496	0.8093	0.5911	0.8044	0.0	4gjr:B, 6lew:B, 4osi:B, 4osq:B, 4osr:B, 4oss:B, 4osv:B, 4osw:B, 4oto:B, 3v6t:B
4	2ypf:A	675	428	0.7465	0.5452	0.8598	0.0	4gjr:B, 6lew:B, 4osi:B, 4osq:B, 4osr:B, 4oss:B, 4osv:B, 4osw:B, 4oto:B, 3v6t:B
5	2ypf:A	675	486	0.7282	0.5319	0.7387	0.0	4gjr:B, 6lew:B, 4osi:B, 4osq:B, 4osr:B, 4oss:B, 4osv:B, 4osw:B, 4oto:B, 3v6t:B
6	2ypf:A	675	411	0.5538	0.4044	0.6642	1.19e-145	4gjr:B, 6lew:B, 4osi:B, 4osq:B, 4osr:B, 4oss:B, 4osv:B, 4osw:B, 4oto:B, 3v6t:B
7	3ugm:A	854	495	0.8621	0.4977	0.8586	0.0
8	3ugm:A	854	493	0.7972	0.4602	0.7972	0.0
9	3ugm:A	854	532	0.7789	0.4496	0.7218	0.0
10	3ugm:A	854	423	0.7181	0.4145	0.8369	0.0
11	3ugm:A	854	338	0.4787	0.2763	0.6982	2.69e-123
12	4cja:A	753	436	0.3205	0.2098	0.3624	3.43e-53
13	4cja:A	753	456	0.3347	0.2191	0.3618	5.73e-50
14	4cja:A	753	399	0.2921	0.1912	0.3609	1.96e-49
15	5d7l:C	242	69	0.0467	0.0950	0.3333	0.36
16	7tve:D	445	143	0.0629	0.0697	0.2168	0.58
17	5jfs:A	277	70	0.0385	0.0686	0.2714	3.4	4aoj:A, 4aoj:B, 4aoj:C, 6dkb:A, 6dkw:B, 6iqn:B, 5jfv:A, 5jfw:A, 5jfx:A
18	7r81:B2	209	60	0.0385	0.0909	0.3167	3.5	7olc:SA, 7old:SA, 8oo0:SA, 7z3n:SA, 7z3o:SA
19	7w0k:A	457	79	0.0365	0.0394	0.2278	8.0	7w0z:A, 7w10:A, 7w1b:A, 7w1h:A

[Back]