MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYG
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3cro:L | 66 | 64 | 1.0000 | 0.9697 | 1.0000 | 8.12e-43 | 3cro:R |
2 | 2or1:L | 63 | 62 | 0.5000 | 0.5079 | 0.5161 | 1.30e-15 | 2or1:R, 1per:L, 1per:R, 1rpe:L, 1rpe:R |
3 | 8tac:B | 66 | 36 | 0.2344 | 0.2273 | 0.4167 | 0.036 | |
4 | 3fym:A | 82 | 64 | 0.3281 | 0.2561 | 0.3281 | 0.049 | |
5 | 4yp9:B | 342 | 50 | 0.2344 | 0.0439 | 0.3000 | 0.12 | 2hj9:A, 2hj9:B, 1jx6:A, 4yp9:A, 4yr7:A, 4yr7:B, 4yrz:A, 4yrz:B |
6 | 7p4a:B | 207 | 28 | 0.1875 | 0.0580 | 0.4286 | 0.35 | |
7 | 8tzj:A | 220 | 66 | 0.3125 | 0.0909 | 0.3030 | 0.80 | 8tzj:B, 8tzk:A, 8tzk:B, 8tzl:A, 8tzl:B |
8 | 1b0n:A | 103 | 55 | 0.2500 | 0.1553 | 0.2909 | 0.86 | 3zkc:A, 3zkc:B |
9 | 4pu4:D | 78 | 61 | 0.2812 | 0.2308 | 0.2951 | 2.4 | 4pu3:D, 4pu3:C, 4pu4:C |
10 | 4kp1:A | 423 | 56 | 0.2812 | 0.0426 | 0.3214 | 2.7 | 4nqy:A, 4nqy:B |
11 | 5ze3:B | 443 | 44 | 0.2344 | 0.0339 | 0.3409 | 2.9 | 5ze3:A |
12 | 3j6b:b | 155 | 26 | 0.2031 | 0.0839 | 0.5000 | 3.5 | 5mrc:b, 5mre:b, 5mrf:b |
13 | 4yg1:A | 72 | 47 | 0.2656 | 0.2361 | 0.3617 | 3.6 | 3dnv:B, 3hzi:B, 5k98:B, 5k98:P, 4yg1:B, 4yg1:C, 4yg1:D, 4yg4:A, 4yg4:B, 4yg4:D, 4yg7:B, 4yg7:E, 4yg7:C, 4yg7:G, 4z58:A, 4z59:A, 4z5c:A, 4z5c:B, 4z5d:A, 4z5d:B, 4z5h:A |
14 | 8t13:B | 877 | 41 | 0.1719 | 0.0125 | 0.2683 | 5.7 | 3evg:A, 1l9k:A, 2p1d:A, 2p3l:A, 2p3o:A, 2p3q:A, 2p40:A, 2p41:A, 1r6a:A, 8t12:B, 7xd8:A, 7xd8:D, 7xd8:G, 7xd8:J, 7xd8:M, 7xd8:P, 7xd9:A, 7xd9:D, 7xd9:G, 7xd9:J, 7xd9:M, 7xd9:P, 5zqk:A, 5zqk:B |
15 | 4wad:A | 498 | 20 | 0.1406 | 0.0181 | 0.4500 | 7.4 | 4x6l:A, 4x6l:B, 4x6l:C, 4x7m:A, 4x7m:B, 4x7r:A, 4x7r:B |
16 | 3kxa:A | 131 | 29 | 0.2031 | 0.0992 | 0.4483 | 7.6 | 3kxa:B, 3kxa:C, 3kxa:D |
17 | 4g2t:A | 356 | 45 | 0.2188 | 0.0393 | 0.3111 | 8.0 | |
18 | 7wnu:B | 554 | 21 | 0.1719 | 0.0199 | 0.5238 | 8.9 | 7wnt:A, 7wnu:A |