BioLiP

>protein
MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLCPNYLFVEFDPEVIHTTTINATRGVSHFVR
FGASPAIVPSAVIHQLSVYKPKGAFEGFQAIFTEPDGEARCMLLLNLINKEIKHSV

The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8pfg:P	136	136	1.0000	1.0000	1.0000	2.52e-101	5ond:A, 5ond:B, 8pib:P
2	8phk:P	162	154	0.9853	0.8272	0.8701	2.94e-94	6c6s:D, 6c6t:D, 8pen:P, 8pfj:P, 8pid:P, 8pil:P, 8pim:P, 8upo:AB, 8upr:AB, 8uql:AB, 8uqm:AB, 8uqp:AB, 8ur0:AB, 8urh:AB, 8uri:AB, 8urx:AB, 8ury:AB
3	8f5g:C	175	93	0.1691	0.1314	0.2473	0.001	8f5g:A
4	8e74:Z	122	93	0.1544	0.1721	0.2258	0.018	8e82:Z
5	7urg:A	401	56	0.1471	0.0499	0.3571	1.8	7urg:B
6	4paw:A	197	51	0.1250	0.0863	0.3333	2.2	4paw:B
7	5d88:A	247	72	0.1397	0.0769	0.2639	4.6
8	2dkk:A	399	32	0.1029	0.0351	0.4375	5.2	2nz5:A, 2nz5:B, 2nza:A, 2nza:B
9	7en2:B	1410	82	0.1691	0.0163	0.2805	6.1	7emy:A, 7emy:B, 7en1:A, 7en1:B, 7en2:A
10	4bmk:A	398	29	0.0882	0.0302	0.4138	8.7	4bmk:B, 2jg2:A, 2w8j:A, 2w8t:A, 2w8u:A, 2w8v:A, 2w8w:A, 2xbn:A
11	4wp8:B	166	64	0.1103	0.0904	0.2344	9.1	5d0e:A, 5d0e:B, 5d0g:A, 5d0g:B, 5d0h:A, 5d0h:B, 5d15:A, 5d15:B, 4wp8:A, 4wp9:A, 4wp9:B, 4wpa:A, 4wpa:B

[Back]