MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPLCPNYLFVEFDPEVIHTTTINATRGVSHFVR
FGASPAIVPSAVIHQLSVYKPEGAFEGFQAIFTEPDGEARCMLLLNLINKEIKHS
The query sequence (length=135) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8pfg:P | 136 | 135 | 0.9926 | 0.9853 | 0.9926 | 4.53e-100 | 5ond:A, 5ond:B, 8pib:P |
2 | 8phk:P | 162 | 153 | 0.9852 | 0.8210 | 0.8693 | 1.16e-93 | 6c6s:D, 6c6t:D, 8pen:P, 8pfj:P, 8pid:P, 8pil:P, 8pim:P, 8upo:AB, 8upr:AB, 8uql:AB, 8uqm:AB, 8uqp:AB, 8ur0:AB, 8urh:AB, 8uri:AB, 8urx:AB, 8ury:AB |
3 | 8f5g:C | 175 | 93 | 0.1704 | 0.1314 | 0.2473 | 0.001 | 8f5g:A |
4 | 8e74:Z | 122 | 93 | 0.1556 | 0.1721 | 0.2258 | 0.018 | 8e82:Z |
5 | 4paw:A | 197 | 51 | 0.1259 | 0.0863 | 0.3333 | 2.1 | 4paw:B |
6 | 5d88:A | 247 | 72 | 0.1407 | 0.0769 | 0.2639 | 4.2 | |
7 | 2dkk:A | 399 | 32 | 0.1037 | 0.0351 | 0.4375 | 5.1 | 2nz5:A, 2nz5:B, 2nza:A, 2nza:B |
8 | 7en2:B | 1410 | 82 | 0.1704 | 0.0163 | 0.2805 | 6.9 | 7emy:A, 7emy:B, 7en1:A, 7en1:B, 7en2:A |
9 | 4bmk:A | 398 | 29 | 0.0889 | 0.0302 | 0.4138 | 8.7 | 4bmk:B, 2jg2:A, 2w8j:A, 2w8t:A, 2w8u:A, 2w8v:A, 2w8w:A, 2xbn:A |