MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAE
The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4zm2:B | 61 | 55 | 1.0000 | 0.9016 | 1.0000 | 1.96e-34 | 4zm0:C, 4zm0:D, 4zm0:A, 4zm0:B, 4zm2:D, 4zm2:C, 4zm2:A |
2 | 6ke6:RC | 278 | 31 | 0.2000 | 0.0396 | 0.3548 | 1.1 | 7d5s:RC, 6lqp:RC, 6lqq:RC, 6lqu:RC, 4qmf:B, 4qmf:D, 7suk:NK, 5wyj:K1, 5wyk:K1, 6zqa:JO |
3 | 8sq0:A | 1402 | 24 | 0.1455 | 0.0057 | 0.3333 | 5.5 | 8sq0:B, 8sql:A, 8sqm:A |
4 | 5zmm:A | 530 | 18 | 0.1636 | 0.0170 | 0.5000 | 6.2 | 5zmm:B, 5zmm:C, 5zmm:E, 5zmm:F, 5zmn:A, 5zmo:A |
5 | 6zqb:JO | 236 | 30 | 0.2000 | 0.0466 | 0.3667 | 6.5 | 7ajt:JO, 6zqc:JO |
6 | 2f9r:A | 285 | 20 | 0.1818 | 0.0351 | 0.5000 | 6.7 | 2f9r:B, 2f9r:C, 2f9r:D, 1xx1:A, 1xx1:B, 1xx1:C, 1xx1:D |
7 | 2liq:A | 153 | 24 | 0.2000 | 0.0719 | 0.4583 | 8.4 | 4uso:A |
8 | 1rnb:A | 109 | 35 | 0.1636 | 0.0826 | 0.2571 | 9.6 | 1a2p:C, 1b2z:C, 1brg:C, 1brh:C, 1brj:C, 1brk:C, 1brn:L, 1brn:M, 2f4y:C, 2f56:A, 2f56:B, 2f5m:B, 2f5m:C, 2f5w:C |