BioLiP

>protein
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL

The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1c9o:A	66	66	1.0000	1.0000	1.0000	7.50e-43	1c9o:B, 2hax:A, 2hax:B
2	2es2:A	67	65	0.8333	0.8209	0.8462	6.46e-35	3pf4:B, 3pf5:B, 3pf5:A
3	7ot5:B	66	64	0.5606	0.5606	0.5781	8.59e-21
4	6a6j:A	90	66	0.4394	0.3222	0.4394	5.71e-11	6a6j:C, 6a6l:A, 6ktc:A, 6kug:A, 6lmr:A, 5yts:A, 5ytt:A, 5ytv:A, 5ytx:A
5	7f3i:A	93	66	0.4242	0.3011	0.4242	2.65e-10	7f3i:C, 7f3i:E, 7f3j:A, 7f3j:C, 7f3j:E, 7f3j:G, 7f3k:A, 7f3l:A
6	7oii:B	39	38	0.3333	0.5641	0.5789	7.87e-10
7	4a75:A	89	69	0.3788	0.2809	0.3623	1.30e-08	4a75:C, 4a75:E, 4a75:G, 4a76:A, 4a76:G, 4a76:C, 4a76:E, 4alp:A, 4alp:D
8	5udz:A	139	69	0.3485	0.1655	0.3333	1.02e-07	8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B
9	7zhh:A	219	67	0.3182	0.0959	0.3134	0.007
10	2cb1:A	404	15	0.1667	0.0272	0.7333	0.78
11	8d1x:D	469	55	0.3030	0.0426	0.3636	1.1	8d1x:A, 8d1x:B, 8d1x:C, 8d1x:E, 8d1x:F
12	6yw5:ZZ	312	46	0.2576	0.0545	0.3696	2.0	6ywe:ZZ, 6ywx:ZZ, 6ywy:ZZ
13	8fxi:C	630	47	0.1970	0.0206	0.2766	5.2	8fxi:D
14	4ags:A	445	40	0.2121	0.0315	0.3500	5.7	4ags:B, 4ags:C
15	7ao7:E	402	32	0.1970	0.0323	0.4062	6.5	7ant:A, 7ant:B, 7ao7:A, 7ao7:B, 7ao7:C, 7ao7:D, 7ao7:F
16	2ix1:A	643	17	0.1212	0.0124	0.4706	8.4	2id0:A, 2id0:B, 2id0:C, 2id0:D, 2ix0:A
17	4ejy:A	289	61	0.2576	0.0588	0.2787	8.6	4ejy:B, 4ejz:A, 4ejz:B

[Back]