MQKVTGIKSVDFKIKALGHGVVNWNGPTTDNHTLPKLRGYTNLTGKQATDINFKETPLYISQNCIRHHLFRELKNVLASI
TGLIRGYVVPSSQCKRTSPLLLEDFVDQLGNGNFKTTFGDTEYISYGSISIEQLQFISLDKKFDRAAMVIKEGEGEVIAA
ELQNYIQSLNPSLNPQAIFHSNYVRRGTIFEEGECGILLNDDAVKALVAETLERLANLSIRQAKGYMYVDDITVDYNDSH
KMMRIKRDESEIINEQHAPFAQYFYAK
The query sequence (length=267) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5o7h:C | 278 | 279 | 0.9925 | 0.9532 | 0.9498 | 0.0 | 5o6u:C |
2 | 5o6u:D | 315 | 315 | 1.0000 | 0.8476 | 0.8476 | 0.0 | 5o6u:E, 5o7h:D, 5o7h:E |
3 | 8dt6:C | 381 | 95 | 0.0936 | 0.0656 | 0.2632 | 2.0 | 8dt6:A, 8dt6:B, 8dt6:D |
4 | 5t5i:A | 569 | 31 | 0.0449 | 0.0211 | 0.3871 | 5.0 | 5t5i:I, 5t5m:A, 5t61:A, 5t61:G, 5t61:M, 5t61:S, 5t61:Y, 5t61:e, 5t61:k, 5t61:q |
5 | 7lm0:A | 449 | 124 | 0.1236 | 0.0735 | 0.2661 | 6.0 | 7lm0:B |
6 | 7lld:A | 446 | 124 | 0.1199 | 0.0717 | 0.2581 | 6.6 | 7lld:B, 7lle:A, 7lle:B |
7 | 8odw:A | 612 | 41 | 0.0562 | 0.0245 | 0.3659 | 9.1 | 8odw:B |
8 | 8in6:A | 205 | 60 | 0.0599 | 0.0780 | 0.2667 | 9.4 |