MQIEVTVRNITPIFSAAPGSNYITIDGTINPPPGVSRFPLVRTRMMYVAADVGDGVIKSVPLQIVPGNTMRSLLRRTMLK
HVIEPALVEKGNKLSIGAYATAYSGNATGNPDGVPSSFDEIATMRAHPFIGLFGGGPRMLEGRLMVDSLYPIHTNAERIL
GAGYENEMMSGPITQVVWAFNAHEVVIPGLKWVWRISLDRPTDAQVGLVLLALNKMTNERIAGGHSKDYGRFVIDGVSLN
GEQVWSQSGITGGEQYFDAVAEAIDGLSSKEFEQFAQSAK
The query sequence (length=280) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xg1:F | 287 | 287 | 0.9929 | 0.9686 | 0.9686 | 0.0 | 7xfz:D, 7xg0:G, 7xg2:G, 7xg3:G, 7xg4:G |
2 | 7xg0:D | 331 | 330 | 1.0000 | 0.8459 | 0.8485 | 0.0 | 7xfz:C, 7xg0:C, 7xg0:E, 7xg0:F, 7xg1:C, 7xg1:D, 7xg1:E, 7xg2:C, 7xg2:D, 7xg2:E, 7xg2:F, 7xg3:C, 7xg3:D, 7xg3:E, 7xg3:F, 7xg4:C, 7xg4:D, 7xg4:E, 7xg4:F |
3 | 5zm8:A | 386 | 82 | 0.0786 | 0.0570 | 0.2683 | 1.3 | |
4 | 5lqw:Q | 791 | 74 | 0.0714 | 0.0253 | 0.2703 | 2.2 | |
5 | 7n7i:A | 279 | 77 | 0.0821 | 0.0824 | 0.2987 | 8.1 | 7n7i:B, 7n7i:C |