BioLiP

>protein
MQGSWSVLKKNCSNFFPGLLAFAQQTQEAYGIWLRIYNRQQKYGPTDFVEQSETFSPDYHKRFHSQDKNMWVDKELCTEV
SQKEVARLMTYKLDMWRMAHCAGALLATGGYAIPFGLFWLANDTWVPSSFNLTGEELRAWREAQDLYRYRSAPSYLTDTK
WHFDFHAYPWNETQERAWDDLFEKNDVRRDPKVVRPAAEMYDGFIKFELIRRKSLRHLCRSMNIPTFPMLARLCNGTRVR
DYWNLAWCEDYMVITQRLHESMTDEELYDYAWRRYLAPYDKNLNREQLMERVEDYFEFLGPDFVAHGKAPNLVILTNYVL
GYYNDPAYLEGDISELDKNDYDHLASWGKDAFLRRLEFENGPLRDQVEAHTQRLLAERAAIAK

The query sequence (length=383) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ap6:E	383	383	1.0000	1.0000	1.0000	0.0	8ap6:e, 8ap7:E, 8ap7:e, 8apa:e, 8apb:e, 8apc:e, 8apd:e, 8ape:e, 8apf:e, 8apg:e, 8aph:e, 8apj:e, 8apk:e
2	8u2p:A	401	107	0.0705	0.0673	0.2523	0.64	8t5n:A
3	6xyw:BD	210	128	0.0862	0.1571	0.2578	0.77
4	6c95:A	773	77	0.0601	0.0298	0.2987	5.0	6c9m:A, 6c9m:C, 6ppl:B, 6pw9:B
5	9f1b:DB	837	78	0.0601	0.0275	0.2949	5.6	9f1c:DB, 9f1d:DB, 9fpz:B, 9fq0:B
6	6stt:A	178	43	0.0418	0.0899	0.3721	6.9	6stt:B
7	4yrv:A	288	74	0.0548	0.0729	0.2838	8.6	4hri:B, 4hri:A, 4ynl:B, 4ynl:A, 4ynl:N, 4ynl:M
8	7xva:A	226	42	0.0392	0.0664	0.3571	8.6
9	6ulw:A	1193	51	0.0339	0.0109	0.2549	9.6	6ulw:D, 6ulx:A, 6uly:A, 6uly:B

[Back]