MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6dnh:C | 117 | 60 | 1.0000 | 0.5128 | 1.0000 | 7.68e-39 | 8e3i:C, 8e3q:C, 6fuw:C, 8r8r:C, 2rhk:D, 6urg:C, 6uro:C |
| 2 | 8ro0:O | 342 | 29 | 0.1833 | 0.0322 | 0.3793 | 0.001 | 8ro1:O |
| 3 | 8ch6:U | 295 | 29 | 0.1667 | 0.0339 | 0.3448 | 0.008 | 7a5p:P, 8c6j:M, 6ff4:P, 6ff7:P, 9fmd:O, 8i0p:O, 8i0r:O, 8i0s:O, 8i0t:O, 8i0u:O, 8i0v:O, 8i0w:O, 6icz:O, 6id0:O, 6id1:O, 5mqf:P, 6qdv:M, 7qtt:U, 8ro2:O, 7w59:O, 7w5a:O, 7w5b:O, 5xjc:O, 5yzg:O, 5z56:O, 5z57:O, 6zym:P |
| 4 | 7abi:P | 237 | 29 | 0.1667 | 0.0422 | 0.3448 | 0.011 | 7aav:P, 7abg:P |
| 5 | 5u6k:E | 191 | 24 | 0.1833 | 0.0576 | 0.4583 | 2.2 | 5u6k:A, 5u6k:B, 5u6k:C, 5u6k:D |
| 6 | 4cs7:C | 172 | 21 | 0.1167 | 0.0407 | 0.3333 | 2.5 | 4cs7:A, 4cs7:B, 4cs7:E, 4cs8:A, 4cs8:B, 4cs8:C, 4cs8:E, 4cs9:A, 4cs9:B, 4cs9:C, 4cs9:E, 4csa:C, 4csa:A, 4csa:B, 4csa:E |
| 7 | 5b4x:A | 710 | 20 | 0.1500 | 0.0127 | 0.4500 | 2.7 | 3a7q:A, 5b4x:C, 2e26:A |
| 8 | 5h7n:B | 460 | 35 | 0.1833 | 0.0239 | 0.3143 | 3.8 | 5h7n:A, 4xhs:A, 4xhs:B |
| 9 | 2y0c:A | 461 | 55 | 0.2833 | 0.0369 | 0.3091 | 3.8 | 2y0c:B, 2y0c:C, 2y0c:D, 2y0d:A, 2y0d:B, 2y0d:C, 2y0d:D, 2y0e:A, 2y0e:B, 2y0e:C, 2y0e:D |
| 10 | 1f28:A | 295 | 25 | 0.1833 | 0.0373 | 0.4400 | 4.2 | 1ci7:A, 1ci7:B, 1f28:B, 1f28:C, 1f28:D |
| 11 | 2d9n:A | 77 | 22 | 0.1500 | 0.1169 | 0.4091 | 4.2 | 2rhk:C |
| 12 | 6mfo:A | 333 | 25 | 0.2333 | 0.0420 | 0.5600 | 4.7 | |
| 13 | 5t4m:A | 347 | 25 | 0.2333 | 0.0403 | 0.5600 | 5.3 | 6e8f:A, 6e8f:C, 6e8f:B, 5t4m:B, 5t4n:A, 5t4n:B |
| 14 | 5uly:C | 221 | 25 | 0.2333 | 0.0633 | 0.5600 | 5.8 | 5uly:B |
| 15 | 6k7s:B | 286 | 16 | 0.1333 | 0.0280 | 0.5000 | 5.8 | 6k7r:A, 6k7r:B, 6k7s:A |
| 16 | 4n8y:A | 300 | 18 | 0.1500 | 0.0300 | 0.5000 | 7.3 | 4n8y:B |
| 17 | 6c5l:BC | 120 | 45 | 0.2500 | 0.1250 | 0.3333 | 7.7 | 6c5l:DC, 4v5j:BC, 4v5j:DC, 4v7j:AC, 4v7j:BC, 4v7k:AC, 4v7k:BC, 4v8n:BC, 4v8n:DC, 4v8x:BC, 4v8x:DC |
| 18 | 7d1c:A | 491 | 28 | 0.1500 | 0.0183 | 0.3214 | 9.6 | 4ct0:A, 7d19:A, 7d19:B, 7dli:A, 7dli:B, 7dli:C, 6kx5:A, 6kx6:A, 6kx6:B, 6kx7:A, 6lue:A, 6lue:B, 7wva:A |
umich.edu