MPLVYMNIIMAFAIALAGLLMYRSHLMSSLLCLEGMMLSLFIMSTLIILNTHFTLANMMPIILLVFAACEAALGLSLLVM
VSNTYGTDYV
The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gpn:i | 90 | 90 | 1.0000 | 1.0000 | 1.0000 | 3.89e-58 | |
2 | 6h8k:L | 79 | 66 | 0.2222 | 0.2532 | 0.3030 | 0.017 | |
3 | 7qm2:B | 165 | 81 | 0.2222 | 0.1212 | 0.2469 | 0.050 | 7qf7:A, 7qfa:A, 7qfa:B, 7qfa:C |
4 | 5mlz:A | 355 | 46 | 0.1444 | 0.0366 | 0.2826 | 6.8 | 5mm0:A, 5mm1:A |