MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2kpi:A | 56 | 56 | 1.0000 | 1.0000 | 1.0000 | 1.68e-34 | |
2 | 2hf1:A | 61 | 52 | 0.4643 | 0.4262 | 0.5000 | 7.86e-10 | 2hf1:B |
3 | 6zxw:H | 57 | 55 | 0.3571 | 0.3509 | 0.3636 | 0.067 | |
4 | 1qz7:A | 524 | 21 | 0.2321 | 0.0248 | 0.6190 | 2.9 | 7afw:A, 7ar4:AAA, 4djs:A, 8ei9:A, 8eia:A, 8eib:A, 8eic:A, 2gl7:A, 2gl7:D, 1i7w:A, 1i7w:C, 1jpp:A, 1jpp:B, 1jpw:A, 1jpw:B, 1jpw:C, 3ouw:A, 8ru3:A, 8ru4:A, 8ru4:B, 3sl9:A, 3sl9:E, 3sl9:B, 3sl9:G, 1t08:A, 7uwi:A, 7uwo:A, 8y0p:A, 8y0p:B, 8z10:A |
5 | 6hiy:DA | 1426 | 22 | 0.1964 | 0.0077 | 0.5000 | 3.7 | |
6 | 6hiv:DA | 1557 | 22 | 0.1964 | 0.0071 | 0.5000 | 3.7 | 6hiw:DA, 7pub:DA |
7 | 5xnz:A | 439 | 14 | 0.1786 | 0.0228 | 0.7143 | 3.9 | |
8 | 1p91:A | 268 | 19 | 0.1429 | 0.0299 | 0.4211 | 5.2 | 1p91:B |
9 | 6r2q:A | 265 | 20 | 0.1607 | 0.0340 | 0.4500 | 7.1 | |
10 | 2j6a:A | 136 | 18 | 0.1429 | 0.0588 | 0.4444 | 7.6 | 4qtt:A, 4qtt:C, 4qtu:A, 4qtu:C |