BioLiP

>protein
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIK
EGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG

The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8c6j:L	144	144	1.0000	1.0000	1.0000	1.91e-106	7aav:Q, 7abf:Q, 7abg:Q, 7abi:Q, 8ch6:T, 6ff4:Q, 6ff7:Q, 9fmd:N, 8i0p:N, 8i0r:N, 8i0s:N, 8i0t:N, 8i0u:N, 8i0v:N, 8i0w:N, 6icz:N, 6id0:N, 6id1:N, 5mqf:Q, 8q7n:Q, 6qdv:L, 8qo9:Q, 7qtt:T, 8ro2:N, 7w59:N, 7w5a:N, 7w5b:N, 5xjc:N, 5yzg:N, 5z56:N, 5z57:N, 6zym:Q
2	8ro0:N	142	142	0.6875	0.6972	0.6972	7.93e-79	8ro1:N
3	3jb9:e	144	143	0.5833	0.5833	0.5874	8.31e-58
4	2my1:A	159	154	0.5417	0.4906	0.5065	3.06e-51	7b9v:L, 6bk8:I, 7dco:N, 6exn:L, 5gm6:T, 5gmk:T, 6j6g:T, 6j6h:T, 6j6n:T, 6j6q:T, 5lj3:L, 5lj5:L, 5lqw:E, 5mps:L, 5mq0:L, 5wsg:T, 5y88:L, 5ylz:L
5	2cir:A	288	50	0.0972	0.0486	0.2800	0.76	2ciq:A, 2cis:A
6	4pqg:A	506	35	0.0833	0.0237	0.3429	1.4	4pqg:B
7	6uo8:A	689	55	0.1111	0.0232	0.2909	3.8	7c7q:A, 7c7s:A, 7ca3:A, 7cum:A, 7eb2:C, 4mqf:A, 4mr7:A, 4mr8:A, 4mr9:A, 4mrm:A, 4ms1:A, 4ms3:A, 4ms4:A, 6uo9:A, 6w2x:A, 6w2y:A, 6w2y:B, 6wiv:A
8	5xuh:C	125	38	0.0764	0.0880	0.2895	6.7	5vcb:c, 5vcb:B, 5vcb:M, 5vcb:U, 5vcb:S, 5xuh:B, 5xuh:A
9	5xwy:A	1117	72	0.1389	0.0179	0.2778	9.3
10	5xwp:A	1125	72	0.1389	0.0178	0.2778	9.3	5xwp:B

[Back]