BioLiP

>protein
MPICLVDGCDSDFSNCREYHKRHKVCDVHSKTPVVTINGHKQRFCQQCSRFHALEEFDEGKRSCR

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8j4b:D	65	65	1.0000	1.0000	1.0000	1.69e-44	8j4b:B
2	1ul4:A	81	65	0.5846	0.4691	0.5846	4.17e-24
3	8pfc:L	70	63	0.5385	0.5000	0.5556	2.22e-23	8j49:A, 8pfc:B, 8pfc:D, 8pfc:F, 8pfc:H, 8pfc:J, 8pfc:N, 8pfc:P
4	1wj0:A	58	55	0.5077	0.5690	0.6000	6.12e-21
5	1ul5:A	86	62	0.4769	0.3605	0.5000	1.62e-17
6	6tix:BBB	533	51	0.2308	0.0281	0.2941	1.5	6tix:AAA
7	8d41:A	307	29	0.1846	0.0391	0.4138	2.7	8d41:B
8	6exn:J	342	27	0.1692	0.0322	0.4074	3.0	5lj3:J, 5lj5:J, 5mps:J, 5mq0:J
9	6uej:A	212	20	0.1385	0.0425	0.4500	5.5	6uei:A
10	8rpr:A	338	47	0.2000	0.0385	0.2766	7.5	8ftr:A, 8fts:A, 8ftv:A, 8rww:A, 8rxf:A, 8rxg:A
11	8h2n:A	709	17	0.1385	0.0127	0.5294	8.2	8h2n:B, 8h2n:C, 8h2n:D
12	8aq8:AAA	344	22	0.1538	0.0291	0.4545	8.4	8aq8:BBB, 8aq8:CCC, 8aq8:DDD
13	7aju:UL	779	18	0.1538	0.0128	0.5556	9.0	5wyj:BB, 5wyk:BB, 6zqd:UL, 6zqe:UL, 6zqf:UL
14	7d5s:B2	851	18	0.1538	0.0118	0.5556	9.0	7ajt:UL, 7d4i:B2, 7d5t:B2, 7d63:B2, 6ke6:B2, 6lqp:B2, 6lqq:B2, 6lqr:B2, 6lqs:B2, 6lqt:B2, 6lqu:B2, 6lqv:B2, 7suk:LQ, 5wlc:LQ, 6zqa:UL, 6zqb:UL, 6zqc:UL
15	8bie:A	318	32	0.1231	0.0252	0.2500	9.5	8bie:B, 8bij:A, 8bij:B
16	8bgt:A	319	40	0.1692	0.0345	0.2750	9.5	8bgt:B, 8bgx:A, 8bgx:B, 8bgx:C, 8bgx:D, 8bgy:A, 8bgy:B, 8bgy:C, 8bgy:D, 8bgz:A, 8bgz:B, 8bgz:C, 8bgz:D, 8bh0:A, 8bh0:B, 8bh0:C, 8bh0:D, 8bh0:E, 8bh0:F, 8bh0:G, 8bh0:H, 8bib:A, 8bib:B, 8bib:C, 8bib:D, 8bid:A, 8bid:B, 8bid:C, 8bid:D, 8bih:A, 8bih:B, 8bih:C, 8bih:D, 8bih:E, 8bih:F, 8bih:G, 8bih:H, 8bih:I, 8bih:J, 8bih:K, 8bih:L

[Back]